Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044710
Gene name
Locationscaffold_2:1539625..1542112
Strand+
Gene length (bp)2487
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13976 gag_pre-integrs GAG-pre-integrase domain 6.0E-14 513 583
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.9E-10 88 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 15 800 3.0E-53
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 402 800 1.0E-44
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 384 785 3.0E-28
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 384 785 3.0E-28
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 384 785 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 15 800 3.0E-53
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 402 800 1.0E-44
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 384 785 3.0E-28
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 384 785 3.0E-28
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 384 785 3.0E-28
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 384 785 4.0E-28
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 384 785 4.0E-28
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 384 785 4.0E-28
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 384 785 4.0E-28
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 384 785 5.0E-28
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 384 785 5.0E-28
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 384 785 5.0E-28
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 384 785 5.0E-28
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 352 785 5.0E-28
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 384 785 5.0E-28
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 384 785 5.0E-28
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 384 785 5.0E-28
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 384 785 6.0E-28
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 384 785 6.0E-28
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 384 785 6.0E-28
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 384 785 6.0E-28
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 384 785 6.0E-28
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 384 785 6.0E-28
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 384 785 6.0E-28
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 384 785 7.0E-28
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 384 785 7.0E-28
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 384 785 8.0E-28
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 384 785 1.0E-27
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 384 785 1.0E-27
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 384 785 1.0E-27
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 384 785 1.0E-27
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 384 785 1.0E-27
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 384 785 2.0E-27
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 384 785 4.0E-27
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 370 807 7.0E-26
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 387 807 1.0E-25
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 387 807 2.0E-25
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 387 807 2.0E-25
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 387 807 2.0E-25
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 387 807 2.0E-25
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 387 807 2.0E-25
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 387 807 2.0E-25
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 387 807 2.0E-25
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 387 807 2.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 387 807 2.0E-25
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 387 807 2.0E-25
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 564 785 2.0E-19
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 385 788 2.0E-18
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 385 788 5.0E-18
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 385 788 7.0E-18
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 710 801 5.0E-10
sp|P93293|M300_ARATH Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana GN=AtMg00300 PE=4 SV=1 475 612 5.0E-08
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 573 734 8.0E-08
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 596 750 1.0E-06
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 573 734 3.0E-06
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 575 734 5.0E-06
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 575 734 1.0E-05
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4493 0.5526 0.1227 0.0822 0.1509 0.0502 0.1325 0.2899 0.1333 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup125
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016530
Agaricus bisporus var bisporus H39 AgabiH39|550200
Agaricus bisporus var bisporus H39 AgabiH39|504400
Agaricus bisporus var bisporus H39 AgabiH39|499500
Agaricus bisporus var bisporus H39 AgabiH39|445500
Agaricus bisporus var bisporus H39 AgabiH39|444600
Agaricus bisporus var bisporus H39 AgabiH39|442400
Agaricus bisporus var bisporus H39 AgabiH39|439000
Agaricus bisporus var bisporus H39 AgabiH39|445300
Agaricus bisporus var bisporus H39 AgabiH39|302200
Agaricus bisporus var bisporus H39 AgabiH39|299900
Agaricus bisporus var bisporus H39 AgabiH39|267800
Agaricus bisporus var bisporus H39 AgabiH39|228300
Agaricus bisporus var bisporus H39 AgabiH39|218600
Agaricus bisporus var bisporus H39 AgabiH39|218400
Agaricus bisporus var bisporus H39 AgabiH39|027490
Agaricus bisporus var bisporus H39 AgabiH39|366000
Agaricus bisporus var bisporus H97 AgabiH97|039170
Agaricus bisporus var bisporus H97 AgabiH97|079920
Agaricus bisporus var bisporus H97 AgabiH97|044760
Agaricus bisporus var bisporus H97 AgabiH97|044750
Agaricus bisporus var bisporus H97 AgabiH97|044710 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|039810
Agaricus bisporus var bisporus H97 AgabiH97|039800
Agaricus bisporus var bisporus H97 AgabiH97|036980
Agaricus bisporus var bisporus H97 AgabiH97|012590
Agaricus bisporus var bisporus H97 AgabiH97|035360
Agaricus bisporus var bisporus H97 AgabiH97|032400
Agaricus bisporus var bisporus H97 AgabiH97|030810
Agaricus bisporus var bisporus H97 AgabiH97|027490
Agaricus bisporus var bisporus H97 AgabiH97|025990
Agaricus bisporus var bisporus H97 AgabiH97|016530
Agaricus bisporus var bisporus H97 AgabiH97|104980
Agaricus bisporus var bisporus H97 AgabiH97|036400
Agaricus bisporus var bisporus H97 AgabiH97|105000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044710
MATNTGGNAPPIFADTAKFNGTNWVSWSGMIRIAAELRGVSGYLDGSIPNPATETTLAINVIPPSPTDTTLLPTD
TPWESTTPRAAEWKVRNAWTMGLLIYNTTDPVGLGISIGGTAADAWRSFLDNYEVASEMALLNAEMELRNMMYVD
GQDFTEFISRLRTKWSNANALGAKIDDKSFRSIILNALPRSWDSIVATLYTTKSSRDAIQQLFTHWARISRDRVT
TSQNTSALQVNTQTRNNDRQRSQNSQLVCTNQNCNRRGHTIEFCYWPGGGKAGQFPQGFGRRGGARGNANNTTTG
TYQTSANNTTADSNNKEERKEQQVFALADITDADDDTKVAKVPSNLPIHVLSPNTPSLSFTSVSDTLNVDSTGKG
SQRGGGVGINTTSSTTDAIPTYQTVTLLDSGASDHCFVNKICFSTYNLISPPRQGNAAGKGSTFAISGTGSAELY
TPLNGILTKVVLSDVLHTPHLRSNLISISKLVSRGSSVSFEGSTAIVRNRAGETALVAFKENGLYVIPNANVHAN
AVQAKSTAVSLQTWHRRLGHASIEVVKRMSKEGLVDGMNVAGSAEVSGLCEDCIYGKHTLHPYNNPSPPETKPLE
RVHIDIWGPSPVQSAGGAKYFMLFIDGATSFRKLYFLTTKSADATLMAFKDFHAEAERQTGMVLKEVRLDMGREW
HNELWSTYIKTHGIILNFTTPYAHQQNGKAERSMRTLLDMARTMLADSGLPQKYWADAVQTAAYIRNLIPTTSNP
SLVPAECWSGQRQDVSHLRPFGSTAYAHIPVEIHPSKLSPRSAKLTLVGYYGHTGYNVRATVTEMSQVTPELKNY
RGK*
Coding >AgabiH97|044710
ATGGCGACGAACACAGGCGGAAACGCTCCTCCCATTTTTGCAGACACCGCGAAATTCAACGGAACTAACTGGGTA
TCATGGAGCGGGATGATTCGCATAGCGGCCGAACTTCGAGGTGTTTCCGGCTACCTTGATGGTTCAATCCCCAAC
CCGGCCACTGAAACAACTCTAGCTATCAATGTTATACCACCGTCGCCTACAGATACTACACTTCTGCCAACAGAC
ACACCTTGGGAATCTACCACCCCACGCGCAGCCGAATGGAAAGTACGCAATGCGTGGACCATGGGACTCCTCATA
TACAACACCACTGATCCCGTTGGCCTCGGAATATCGATCGGGGGAACTGCAGCCGACGCATGGAGGTCCTTCCTT
GATAACTATGAAGTAGCCTCCGAGATGGCTCTCCTAAATGCTGAGATGGAGCTAAGGAATATGATGTATGTGGAT
GGACAGGACTTCACGGAGTTTATCTCTCGTCTCAGGACCAAATGGTCCAACGCGAATGCTTTGGGGGCGAAGATC
GATGATAAGTCCTTCCGTTCAATCATACTGAACGCCCTCCCTCGATCTTGGGACTCTATCGTTGCCACATTATAC
ACCACCAAATCGTCTCGCGATGCCATTCAACAACTCTTCACCCACTGGGCTAGAATTAGCCGCGATCGAGTCACA
ACCTCACAAAACACTTCTGCTCTGCAAGTGAACACTCAAACTCGTAACAACGATCGCCAGCGGAGCCAAAACAGC
CAGTTAGTATGTACCAACCAAAACTGTAACCGACGTGGACATACCATCGAGTTTTGCTATTGGCCGGGAGGTGGA
AAGGCAGGCCAGTTCCCACAGGGATTTGGGAGACGTGGGGGTGCTAGAGGTAATGCCAACAATACCACGACTGGA
ACCTACCAGACCTCCGCTAACAACACCACCGCCGACTCCAACAATAAGGAGGAAAGGAAGGAACAGCAAGTTTTC
GCACTTGCTGATATCACTGACGCCGACGACGATACCAAAGTCGCCAAGGTACCATCCAATCTACCAATCCACGTC
CTCTCGCCTAATACTCCATCCCTTTCCTTCACCAGTGTCTCTGATACGTTGAACGTTGATTCTACTGGCAAAGGA
TCACAGAGAGGTGGGGGAGTAGGTATCAATACTACGTCGAGTACAACCGATGCAATTCCAACCTACCAAACAGTC
ACCTTGCTCGATTCCGGAGCTAGTGACCATTGCTTCGTCAATAAAATATGTTTCTCCACATATAACTTGATCTCC
CCTCCTCGACAAGGCAACGCCGCTGGGAAGGGATCGACGTTCGCTATCAGCGGGACTGGGAGCGCAGAACTATAC
ACACCTCTTAATGGAATATTGACGAAAGTGGTTCTGTCAGACGTCTTGCATACTCCGCATTTAAGGTCGAACCTG
ATCTCCATCTCCAAATTGGTCTCGAGAGGATCTTCTGTCAGTTTTGAGGGAAGCACGGCCATTGTCCGGAATAGA
GCTGGCGAAACGGCACTTGTGGCATTCAAGGAAAACGGCTTGTATGTGATACCTAATGCCAACGTTCATGCCAAC
GCTGTACAAGCCAAATCAACGGCGGTATCATTGCAAACTTGGCACAGACGTCTTGGACATGCCAGCATTGAGGTG
GTGAAGAGGATGTCGAAGGAGGGCCTTGTGGATGGAATGAACGTTGCAGGCTCCGCAGAAGTAAGCGGTCTTTGT
GAAGACTGTATATATGGGAAACATACCTTACATCCCTACAATAATCCAAGCCCACCAGAGACTAAGCCTCTCGAA
CGCGTCCACATTGATATCTGGGGTCCTTCCCCGGTTCAGTCAGCCGGGGGAGCTAAATACTTCATGTTATTTATT
GACGGCGCCACATCATTCAGAAAACTATACTTCCTTACCACCAAGTCAGCGGACGCGACGTTAATGGCCTTCAAG
GATTTTCATGCGGAGGCGGAGAGGCAGACTGGGATGGTGCTGAAAGAGGTGAGACTTGACATGGGACGTGAGTGG
CATAATGAGCTTTGGAGTACGTACATAAAAACCCATGGCATCATCCTCAACTTCACTACGCCGTACGCCCACCAG
CAAAATGGGAAGGCCGAACGTTCAATGCGAACCCTGTTGGATATGGCACGCACGATGCTCGCCGATTCTGGACTA
CCCCAGAAGTACTGGGCGGATGCTGTTCAAACTGCCGCGTATATTCGAAACCTCATCCCAACTACCAGTAACCCT
TCCCTGGTCCCTGCAGAATGTTGGTCTGGGCAACGACAAGATGTCTCGCACCTTCGACCCTTCGGCTCTACTGCC
TATGCGCATATACCGGTCGAAATTCATCCTTCTAAATTGTCCCCCCGGTCTGCTAAGCTTACGCTCGTTGGATAT
TATGGTCATACAGGGTATAATGTTAGGGCGACTGTGACTGAGATGTCACAGGTCACACCTGAACTTAAGAACTAT
AGAGGAAAGTGA
Transcript >AgabiH97|044710
ATGGCGACGAACACAGGCGGAAACGCTCCTCCCATTTTTGCAGACACCGCGAAATTCAACGGAACTAACTGGGTA
TCATGGAGCGGGATGATTCGCATAGCGGCCGAACTTCGAGGTGTTTCCGGCTACCTTGATGGTTCAATCCCCAAC
CCGGCCACTGAAACAACTCTAGCTATCAATGTTATACCACCGTCGCCTACAGATACTACACTTCTGCCAACAGAC
ACACCTTGGGAATCTACCACCCCACGCGCAGCCGAATGGAAAGTACGCAATGCGTGGACCATGGGACTCCTCATA
TACAACACCACTGATCCCGTTGGCCTCGGAATATCGATCGGGGGAACTGCAGCCGACGCATGGAGGTCCTTCCTT
GATAACTATGAAGTAGCCTCCGAGATGGCTCTCCTAAATGCTGAGATGGAGCTAAGGAATATGATGTATGTGGAT
GGACAGGACTTCACGGAGTTTATCTCTCGTCTCAGGACCAAATGGTCCAACGCGAATGCTTTGGGGGCGAAGATC
GATGATAAGTCCTTCCGTTCAATCATACTGAACGCCCTCCCTCGATCTTGGGACTCTATCGTTGCCACATTATAC
ACCACCAAATCGTCTCGCGATGCCATTCAACAACTCTTCACCCACTGGGCTAGAATTAGCCGCGATCGAGTCACA
ACCTCACAAAACACTTCTGCTCTGCAAGTGAACACTCAAACTCGTAACAACGATCGCCAGCGGAGCCAAAACAGC
CAGTTAGTATGTACCAACCAAAACTGTAACCGACGTGGACATACCATCGAGTTTTGCTATTGGCCGGGAGGTGGA
AAGGCAGGCCAGTTCCCACAGGGATTTGGGAGACGTGGGGGTGCTAGAGGTAATGCCAACAATACCACGACTGGA
ACCTACCAGACCTCCGCTAACAACACCACCGCCGACTCCAACAATAAGGAGGAAAGGAAGGAACAGCAAGTTTTC
GCACTTGCTGATATCACTGACGCCGACGACGATACCAAAGTCGCCAAGGTACCATCCAATCTACCAATCCACGTC
CTCTCGCCTAATACTCCATCCCTTTCCTTCACCAGTGTCTCTGATACGTTGAACGTTGATTCTACTGGCAAAGGA
TCACAGAGAGGTGGGGGAGTAGGTATCAATACTACGTCGAGTACAACCGATGCAATTCCAACCTACCAAACAGTC
ACCTTGCTCGATTCCGGAGCTAGTGACCATTGCTTCGTCAATAAAATATGTTTCTCCACATATAACTTGATCTCC
CCTCCTCGACAAGGCAACGCCGCTGGGAAGGGATCGACGTTCGCTATCAGCGGGACTGGGAGCGCAGAACTATAC
ACACCTCTTAATGGAATATTGACGAAAGTGGTTCTGTCAGACGTCTTGCATACTCCGCATTTAAGGTCGAACCTG
ATCTCCATCTCCAAATTGGTCTCGAGAGGATCTTCTGTCAGTTTTGAGGGAAGCACGGCCATTGTCCGGAATAGA
GCTGGCGAAACGGCACTTGTGGCATTCAAGGAAAACGGCTTGTATGTGATACCTAATGCCAACGTTCATGCCAAC
GCTGTACAAGCCAAATCAACGGCGGTATCATTGCAAACTTGGCACAGACGTCTTGGACATGCCAGCATTGAGGTG
GTGAAGAGGATGTCGAAGGAGGGCCTTGTGGATGGAATGAACGTTGCAGGCTCCGCAGAAGTAAGCGGTCTTTGT
GAAGACTGTATATATGGGAAACATACCTTACATCCCTACAATAATCCAAGCCCACCAGAGACTAAGCCTCTCGAA
CGCGTCCACATTGATATCTGGGGTCCTTCCCCGGTTCAGTCAGCCGGGGGAGCTAAATACTTCATGTTATTTATT
GACGGCGCCACATCATTCAGAAAACTATACTTCCTTACCACCAAGTCAGCGGACGCGACGTTAATGGCCTTCAAG
GATTTTCATGCGGAGGCGGAGAGGCAGACTGGGATGGTGCTGAAAGAGGTGAGACTTGACATGGGACGTGAGTGG
CATAATGAGCTTTGGAGTACGTACATAAAAACCCATGGCATCATCCTCAACTTCACTACGCCGTACGCCCACCAG
CAAAATGGGAAGGCCGAACGTTCAATGCGAACCCTGTTGGATATGGCACGCACGATGCTCGCCGATTCTGGACTA
CCCCAGAAGTACTGGGCGGATGCTGTTCAAACTGCCGCGTATATTCGAAACCTCATCCCAACTACCAGTAACCCT
TCCCTGGTCCCTGCAGAATGTTGGTCTGGGCAACGACAAGATGTCTCGCACCTTCGACCCTTCGGCTCTACTGCC
TATGCGCATATACCGGTCGAAATTCATCCTTCTAAATTGTCCCCCCGGTCTGCTAAGCTTACGCTCGTTGGATAT
TATGGTCATACAGGGTATAATGTTAGGGCGACTGTGACTGAGATGTCACAGGTCACACCTGAACTTAAGAACTAT
AGAGGAAAGTGA
Gene >AgabiH97|044710
ATGGCGACGAACACAGGCGGAAACGCTCCTCCCATTTTTGCAGACACCGCGAAATTCAACGGAACTAACTGGGTA
TCATGGAGCGGGATGATTCGCATAGCGGCCGAACTTCGAGGTGTTTCCGGCTACCTTGATGGTTCAATCCCCAAC
CCGGCCACTGAAACAACTCTAGCTATCAATGTTATACCACCGTCGCCTACAGATACTACACTTCTGCCAACAGAC
ACACCTTGGGAATCTACCACCCCACGCGCAGCCGAATGGAAAGTACGCAATGCGTGGACCATGGGACTCCTCATA
TACAACACCACTGATCCCGTTGGCCTCGGAATATCGATCGGGGGAACTGCAGCCGACGCATGGAGGTCCTTCCTT
GATAACTATGAAGTAGCCTCCGAGATGGCTCTCCTAAATGCTGAGATGGAGCTAAGGAATATGATGTATGTGGAT
GGACAGGACTTCACGGAGTTTATCTCTCGTCTCAGGACCAAATGGTCCAACGCGAATGCTTTGGGGGCGAAGATC
GATGATAAGTCCTTCCGTTCAATCATACTGAACGCCCTCCCTCGATCTTGGGACTCTATCGTTGCCACATTATAC
ACCACCAAATCGTCTCGCGATGCCATTCAACAACTCTTCACCCACTGGGCTAGAATTAGCCGCGATCGAGTCACA
ACCTCACAAAACACTTCTGCTCTGCAAGTGAACACTCAAACTCGTAACAACGATCGCCAGCGGAGCCAAAACAGC
CAGTTAGTATGTACCAACCAAAACTGTAACCGACGTGGACATACCATCGAGTTTTGCTATTGGCCGGGAGGTGGA
AAGGCAGGCCAGTTCCCACAGGGATTTGGGAGACGTGGGGGTGCTAGAGGTAATGCCAACAATACCACGACTGGA
ACCTACCAGACCTCCGCTAACAACACCACCGCCGACTCCAACAATAAGGAGGAAAGGAAGGAACAGCAAGTTTTC
GCACTTGCTGATATCACTGACGCCGACGACGATACCAAAGTCGCCAAGGTACCATCCAATCTACCAATCCACGTC
CTCTCGCCTAATACTCCATCCCTTTCCTTCACCAGTGTCTCTGATACGTTGAACGTTGATTCTACTGGCAAAGGA
TCACAGAGAGGTGGGGGAGTAGGTATCAATACTACGTCGAGTACAACCGATGCAATTCCAACCTACCAAACAGTC
ACCTTGCTCGATTCCGGAGCTAGTGACCATTGCTTCGTCAATAAAATATGTTTCTCCACATATAACTTGATCTCC
CCTCCTCGACAAGGCAACGCCGCTGGGAAGGGATCGACGTTCGCTATCAGCGGGACTGGGAGCGCAGAACTATAC
ACACCTCTTAATGGAATATTGACGAAAGTGGTTCTGTCAGACGTCTTGCATACTCCGCATTTAAGGTCGAACCTG
ATCTCCATCTCCAAATTGGTCTCGAGAGGATCTTCTGTCAGTTTTGAGGGAAGCACGGCCATTGTCCGGAATAGA
GCTGGCGAAACGGCACTTGTGGCATTCAAGGAAAACGGCTTGTATGTGATACCTAATGCCAACGTTCATGCCAAC
GCTGTACAAGCCAAATCAACGGCGGTATCATTGCAAACTTGGCACAGACGTCTTGGACATGCCAGCATTGAGGTG
GTGAAGAGGATGTCGAAGGAGGGCCTTGTGGATGGAATGAACGTTGCAGGCTCCGCAGAAGTAAGCGGTCTTTGT
GAAGACTGTATATATGGGAAACATACCTTACATCCCTACAATAATCCAAGCCCACCAGAGACTAAGCCTCTCGAA
CGCGTCCACATTGATATCTGGGGTCCTTCCCCGGTTCAGTCAGCCGGGGGAGCTAAATACTTCATGTTATTTATT
GACGGCGCCACATCATTCAGAAAACTATACTTCCTTACCACCAAGTCAGCGGACGCGACGTTAATGGCCTTCAAG
GATTTTCATGCGGAGGCGGAGAGGCAGACTGGGATGGTGCTGAAAGAGGTGAGACTTGACATGGGACGTGAGTGG
CATAATGAGCTTTGGAGTACGTACATAAAAACCCATGGCATCATCCTCAACTTCACTACGCCGTACGCCCACCAG
CAAAATGGGAAGGCCGAACGTTCAATGCGAACCCTGTTGGATATGGCACGCACGATGCTCGCCGATTCTGGACTA
CCCCAGAAGTACTGGGCGGATGCTGTTCAAACTGCCGCGTATATTCGAAACCTCATCCCAACTACCAGTAACCCT
TCCCTGGTCCCTGCAGAATGTTGGTCTGGGCAACGACAAGATGTCTCGCACCTTCGACCCTTCGGCTCTACTGCC
TATGCGCATATACCGGTCGAAATTCATCCTTCTAAATTGTCCCCCCGGTCTGCTAAGCTTACGCTCGTTGGATAT
TATGGTCATACAGGGTATAATGTTAGGGCGACTGTGACTGAGATGTCACAGGTCACACCTGAACTTAAGAACTAT
AGAGGAAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail