Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044680
Gene name
Locationscaffold_2:1531552..1532614
Strand+
Gene length (bp)1062
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02045 CBFB_NFYA CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B 3.9E-27 105 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06774|HAP2_YEAST Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 102 195 1.0E-30
sp|P53768|HAP2_KLULA Transcriptional activator HAP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP2 PE=3 SV=1 104 170 1.0E-27
sp|P24488|HAP2_SCHPO Transcriptional activator hap2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap2 PE=3 SV=1 105 223 1.0E-23
sp|Q9LXV5|NFYA1_ARATH Nuclear transcription factor Y subunit A-1 OS=Arabidopsis thaliana GN=NFYA1 PE=2 SV=1 96 207 3.0E-21
sp|Q945M9|NFYA9_ARATH Nuclear transcription factor Y subunit A-9 OS=Arabidopsis thaliana GN=NFYA9 PE=2 SV=1 86 176 5.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06774|HAP2_YEAST Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 102 195 1.0E-30
sp|P53768|HAP2_KLULA Transcriptional activator HAP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP2 PE=3 SV=1 104 170 1.0E-27
sp|P24488|HAP2_SCHPO Transcriptional activator hap2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap2 PE=3 SV=1 105 223 1.0E-23
sp|Q9LXV5|NFYA1_ARATH Nuclear transcription factor Y subunit A-1 OS=Arabidopsis thaliana GN=NFYA1 PE=2 SV=1 96 207 3.0E-21
sp|Q945M9|NFYA9_ARATH Nuclear transcription factor Y subunit A-9 OS=Arabidopsis thaliana GN=NFYA9 PE=2 SV=1 86 176 5.0E-20
sp|Q54S29|NFYA_DICDI Nuclear transcription factor Y subunit alpha OS=Dictyostelium discoideum GN=nfyA PE=3 SV=1 99 167 5.0E-20
sp|Q5E9S2|NFYA_BOVIN Nuclear transcription factor Y subunit alpha OS=Bos taurus GN=NFYA PE=2 SV=1 102 162 9.0E-20
sp|P18576|NFYA_RAT Nuclear transcription factor Y subunit alpha OS=Rattus norvegicus GN=Nfya PE=1 SV=1 102 162 9.0E-20
sp|P23511|NFYA_HUMAN Nuclear transcription factor Y subunit alpha OS=Homo sapiens GN=NFYA PE=1 SV=2 102 162 1.0E-19
sp|Q84JP1|NFYA7_ARATH Nuclear transcription factor Y subunit A-7 OS=Arabidopsis thaliana GN=NFYA7 PE=2 SV=1 104 165 1.0E-19
sp|P23708|NFYA_MOUSE Nuclear transcription factor Y subunit alpha OS=Mus musculus GN=Nfya PE=1 SV=2 102 162 1.0E-19
sp|Q9LNP6|NFYA8_ARATH Nuclear transcription factor Y subunit A-8 OS=Arabidopsis thaliana GN=NFYA8 PE=2 SV=2 93 177 6.0E-19
sp|Q9SYH4|NFYA5_ARATH Nuclear transcription factor Y subunit A-5 OS=Arabidopsis thaliana GN=NFYA5 PE=2 SV=1 84 166 2.0E-18
sp|Q93ZH2|NFYA3_ARATH Nuclear transcription factor Y subunit A-3 OS=Arabidopsis thaliana GN=NFYA3 PE=2 SV=2 96 166 3.0E-18
sp|Q8VY64|NFYA4_ARATH Nuclear transcription factor Y subunit A-4 OS=Arabidopsis thaliana GN=NFYA4 PE=2 SV=1 96 165 4.0E-18
sp|Q8LFU0|NFYAA_ARATH Nuclear transcription factor Y subunit A-10 OS=Arabidopsis thaliana GN=NFYA10 PE=2 SV=2 96 206 7.0E-18
sp|Q9LVJ7|NFYA6_ARATH Nuclear transcription factor Y subunit A-6 OS=Arabidopsis thaliana GN=NFYA6 PE=2 SV=1 103 165 3.0E-17
sp|Q9M9X4|NFYA2_ARATH Nuclear transcription factor Y subunit A-2 OS=Arabidopsis thaliana GN=NFYA2 PE=2 SV=1 96 161 5.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:0140110 transcription regulator activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCAAT-binding TF

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044680
MDLHDVQQQQQHAVQHSLHPQPHIVHNALHDIHHHQHTQLDHHLHIAQNDQLFRPFYREPDHFQLYNNHDIFQGQ
PSDPPTPPSPPKSAAPQSQPPLELANIDDEPLYVNAKQYFRILKRRVARTRLEEVHRLSRQRKPYLHESRHKHAM
RRPRGPGGRFLTASEIAAQKLAAQDEPRSAANPAADPDPDDEPEDDDSKPDDSSVSPAPDSEVFMSHQPPPDSMG
IINMAYRPIPHHLSHHPPPPSIAMSQSRQPPSPPSIYPQTQPQPQPSQQEPQDKSPSVTLTSPYSVQMHHVPHPH
AHARHHHSINPYMYNADAVDPSTDSTEEMIQFSAGPP*
Coding >AgabiH97|044680
ATGGACCTCCACGACGTCCAGCAACAGCAGCAGCACGCTGTCCAGCACAGCCTGCACCCGCAGCCGCACATCGTC
CACAACGCCCTCCACGACATCCACCACCACCAGCACACCCAGCTCGACCACCACCTCCACATCGCACAGAACGAC
CAGCTCTTTCGCCCCTTTTACAGAGAGCCAGACCACTTCCAGCTCTACAACAACCACGACATCTTTCAGGGCCAG
CCCTCTGATCCTCCCACCCCGCCCTCCCCGCCCAAGTCTGCCGCCCCGCAGTCCCAACCACCCCTCGAGCTCGCA
AACATCGACGACGAGCCCCTCTATGTCAACGCAAAGCAGTACTTTCGCATCCTCAAGCGCAGAGTAGCCCGCACC
CGCCTCGAAGAGGTCCACCGCCTCTCCCGCCAGCGCAAGCCCTATCTTCACGAATCTCGTCACAAACATGCCATG
CGTCGCCCCAGAGGCCCTGGCGGCCGCTTCCTCACCGCAAGCGAGATTGCCGCCCAAAAGCTCGCTGCCCAAGAC
GAGCCCCGCTCAGCCGCCAACCCAGCCGCTGACCCCGACCCCGACGACGAACCCGAAGACGACGACTCCAAACCA
GACGATTCCTCCGTCAGTCCCGCCCCCGATTCAGAGGTCTTCATGTCTCATCAGCCTCCTCCCGATTCCATGGGC
ATCATCAACATGGCCTACCGCCCCATCCCTCACCATCTATCTCACCACCCGCCCCCTCCCTCGATTGCAATGTCC
CAATCCCGTCAGCCACCGTCTCCGCCCTCCATCTACCCCCAAACACAGCCGCAACCTCAGCCGTCGCAGCAAGAA
CCTCAGGATAAAAGTCCTTCCGTCACTCTCACCTCCCCTTATTCTGTCCAGATGCACCACGTCCCTCACCCCCAT
GCACACGCCAGGCATCATCATTCTATCAACCCGTACATGTACAATGCAGACGCCGTCGATCCCAGCACTGACTCG
ACGGAGGAGATGATTCAGTTCAGTGCCGGTCCACCTTGA
Transcript >AgabiH97|044680
ATGGACCTCCACGACGTCCAGCAACAGCAGCAGCACGCTGTCCAGCACAGCCTGCACCCGCAGCCGCACATCGTC
CACAACGCCCTCCACGACATCCACCACCACCAGCACACCCAGCTCGACCACCACCTCCACATCGCACAGAACGAC
CAGCTCTTTCGCCCCTTTTACAGAGAGCCAGACCACTTCCAGCTCTACAACAACCACGACATCTTTCAGGGCCAG
CCCTCTGATCCTCCCACCCCGCCCTCCCCGCCCAAGTCTGCCGCCCCGCAGTCCCAACCACCCCTCGAGCTCGCA
AACATCGACGACGAGCCCCTCTATGTCAACGCAAAGCAGTACTTTCGCATCCTCAAGCGCAGAGTAGCCCGCACC
CGCCTCGAAGAGGTCCACCGCCTCTCCCGCCAGCGCAAGCCCTATCTTCACGAATCTCGTCACAAACATGCCATG
CGTCGCCCCAGAGGCCCTGGCGGCCGCTTCCTCACCGCAAGCGAGATTGCCGCCCAAAAGCTCGCTGCCCAAGAC
GAGCCCCGCTCAGCCGCCAACCCAGCCGCTGACCCCGACCCCGACGACGAACCCGAAGACGACGACTCCAAACCA
GACGATTCCTCCGTCAGTCCCGCCCCCGATTCAGAGGTCTTCATGTCTCATCAGCCTCCTCCCGATTCCATGGGC
ATCATCAACATGGCCTACCGCCCCATCCCTCACCATCTATCTCACCACCCGCCCCCTCCCTCGATTGCAATGTCC
CAATCCCGTCAGCCACCGTCTCCGCCCTCCATCTACCCCCAAACACAGCCGCAACCTCAGCCGTCGCAGCAAGAA
CCTCAGGATAAAAGTCCTTCCGTCACTCTCACCTCCCCTTATTCTGTCCAGATGCACCACGTCCCTCACCCCCAT
GCACACGCCAGGCATCATCATTCTATCAACCCGTACATGTACAATGCAGACGCCGTCGATCCCAGCACTGACTCG
ACGGAGGAGATGATTCAGTTCAGTGCCGGTCCACCTTGA
Gene >AgabiH97|044680
ATGGACCTCCACGACGTCCAGCAACAGCAGCAGCACGCTGTCCAGCACAGCCTGCACCCGCAGCCGCACATCGTC
CACAACGCCCTCCACGACATCCACCACCACCAGCACACCCAGCTCGACCACCACCTCCACATCGCACAGAACGAC
CAGCTCTTTCGCCCCTTTTACAGAGAGCCAGACCACTTCCAGCTCTACAACAACCACGACATCTTTCAGGGCCAG
CCCTCTGATCCTCCCACCCCGCCCTCCCCGCCCAAGTCTGCCGCCCCGCAGTCCCAACCACCCCTCGAGCTCGCA
AACATCGACGACGAGCCCCTCTATGTCAACGCAAAGCAGTACTTTCGCATCCTCAAGCGCAGAGTAGCCCGCACC
CGCCTCGAAGAGGTCCACCGCCTCTCCCGCCAGCGCAAGGTACATTCGCATCTTCCTCCTCACTAGCCCCATCTG
ACTTCTTTCTAGCCCTATCTTCACGAATCTCGTCACAAACATGCCATGCGTCGCCCCAGAGGCCCTGGCGGCCGC
TTCCTCACCGCAAGCGAGATTGCCGCCCAAAAGCTCGCTGCCCAAGACGAGCCCCGCTCAGCCGCCAACCCAGCC
GCTGACCCCGACCCCGACGACGAACCCGAAGACGACGACTCCAAACCAGACGATTCCTCCGTCAGTCCCGCCCCC
GATTCAGAGGTCTTCATGTCTCATCAGCCTCCTCCCGATTCCATGGGCATCATCAACATGGCCTACCGCCCCATC
CCTCACCATCTATCTCACCACCCGCCCCCTCCCTCGATTGCAATGTCCCAATCCCGTCAGCCACCGTCTCCGCCC
TCCATCTACCCCCAAACACAGCCGCAACCTCAGCCGTCGCAGCAAGAACCTCAGGATAAAAGTCCTTCCGTCACT
CTCACCTCCCCTTATTCTGTCCAGATGCACCACGTCCCTCACCCCCATGCACACGCCAGGCATCATCATTCTATC
AACCCGTACATGTACAATGCAGACGCCGTCGATCCCAGCACTGACTCGACGGAGGAGATGATTCAGTTCAGTGCC
GGTCCACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail