Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044660
Gene name
Locationscaffold_2:1529456..1530841
Strand-
Gene length (bp)1385
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 1.6E-23 73 337

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 62 405 2.0E-28
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 78 356 8.0E-20
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 80 405 3.0E-16
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 80 405 7.0E-16
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 80 405 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 62 405 2.0E-28
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 78 356 8.0E-20
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 80 405 3.0E-16
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 80 405 7.0E-16
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 80 405 1.0E-15
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 80 405 1.0E-15
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 80 405 2.0E-15
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 80 405 5.0E-15
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 80 405 8.0E-15
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 29 334 7.0E-08
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 77 349 1.0E-07
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 59 334 3.0E-07
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 76 346 3.0E-07
sp|O82302|P2C29_ARATH Protein phosphatase 2C 29 OS=Arabidopsis thaliana GN=PLL1 PE=1 SV=2 212 348 5.0E-07
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 177 299 6.0E-07
sp|A3AZ89|P2C46_ORYSJ Putative protein phosphatase 2C 46 OS=Oryza sativa subsp. japonica GN=Os05g0111800 PE=3 SV=2 136 343 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044660
MTSSTQSTNLGWPDQETICKYTSYTEPLLSSELARRASATTLGDTHLVSFQPSPNPHFANQDRYVVQDWPLPDGL
WSFRAIFDGHGGHATVDYATQVLPTQLKQHLEARSQSHPDYISQLLHDTIVNFDESLKRDLLAILPDVDVIAQMT
NDKLHTLVGDLQASEDSDMVLKRCMHGTTALIALFDPPKRNLWVATLGDGIAALGKKDHLGKWSASLLSSFHNGC
NDAEVEQIRKDHPGEAECVRNNRVLGAIAVTRALGDHCFKLSSIFSDQIFSRTYPGFSFSATSLEEIIARNLTPP
YVSNRPDVQHVNLNNDQYQETRLIMCSDGLVDLYLDQSESLTQEQLPEIWLRALDKRDTSSNTGDNLALALLRHA
LGGEDAETVSRNMTLEYEEAKWMDDTTILVQGI*
Coding >AgabiH97|044660
ATGACTTCCTCCACCCAATCCACAAACCTGGGCTGGCCAGACCAAGAAACCATCTGCAAGTACACCTCTTACACA
GAACCCCTTCTCTCTTCAGAACTCGCTCGTCGAGCCTCTGCCACCACCCTCGGCGATACTCATCTCGTTTCCTTT
CAGCCCTCCCCCAACCCCCACTTTGCCAACCAAGACCGCTACGTCGTCCAGGACTGGCCTCTTCCCGACGGTCTC
TGGTCTTTTCGTGCCATCTTTGATGGTCACGGCGGTCATGCAACAGTCGATTACGCCACACAGGTCCTTCCGACC
CAGCTCAAACAGCATCTCGAAGCTAGATCACAGTCTCATCCTGACTATATATCCCAGCTCCTCCATGATACCATT
GTTAATTTTGACGAAAGTCTGAAGCGCGACCTTCTTGCCATTCTTCCCGACGTCGACGTTATTGCTCAGATGACC
AACGACAAACTCCATACCCTGGTTGGCGACCTTCAAGCCTCGGAAGACAGCGACATGGTCCTCAAGCGATGCATG
CATGGCACCACCGCTCTCATCGCTCTCTTTGATCCTCCCAAGCGTAACCTGTGGGTTGCTACTCTGGGTGATGGA
ATAGCAGCCCTCGGCAAGAAAGATCATCTAGGAAAGTGGTCTGCGTCTCTTCTCAGTTCATTCCACAACGGGTGC
AACGACGCCGAAGTTGAGCAAATTCGTAAAGACCACCCTGGCGAGGCGGAATGCGTTCGAAACAACCGAGTCCTC
GGCGCCATTGCGGTCACGAGAGCTCTCGGCGATCACTGTTTCAAACTGTCCTCCATCTTTAGCGACCAGATATTT
TCACGCACCTATCCAGGCTTTTCTTTCTCAGCTACCAGTCTTGAAGAAATTATAGCACGTAATCTGACTCCACCC
TATGTGTCCAATCGTCCGGACGTCCAGCACGTCAATTTAAATAACGACCAATACCAAGAGACACGCTTGATCATG
TGTTCAGATGGCCTCGTCGACTTGTACTTGGATCAGTCTGAATCCTTGACTCAAGAGCAGCTACCCGAGATCTGG
CTCAGAGCTCTCGACAAACGCGACACATCGTCAAATACTGGGGATAACCTTGCTCTGGCTCTGCTTCGCCATGCC
CTCGGAGGGGAGGATGCTGAGACAGTATCGAGGAACATGACTTTGGAATATGAGGAAGCAAAGTGGATGGATGAC
ACAACTATCTTAGTACAGGGAATTTAG
Transcript >AgabiH97|044660
ATGACTTCCTCCACCCAATCCACAAACCTGGGCTGGCCAGACCAAGAAACCATCTGCAAGTACACCTCTTACACA
GAACCCCTTCTCTCTTCAGAACTCGCTCGTCGAGCCTCTGCCACCACCCTCGGCGATACTCATCTCGTTTCCTTT
CAGCCCTCCCCCAACCCCCACTTTGCCAACCAAGACCGCTACGTCGTCCAGGACTGGCCTCTTCCCGACGGTCTC
TGGTCTTTTCGTGCCATCTTTGATGGTCACGGCGGTCATGCAACAGTCGATTACGCCACACAGGTCCTTCCGACC
CAGCTCAAACAGCATCTCGAAGCTAGATCACAGTCTCATCCTGACTATATATCCCAGCTCCTCCATGATACCATT
GTTAATTTTGACGAAAGTCTGAAGCGCGACCTTCTTGCCATTCTTCCCGACGTCGACGTTATTGCTCAGATGACC
AACGACAAACTCCATACCCTGGTTGGCGACCTTCAAGCCTCGGAAGACAGCGACATGGTCCTCAAGCGATGCATG
CATGGCACCACCGCTCTCATCGCTCTCTTTGATCCTCCCAAGCGTAACCTGTGGGTTGCTACTCTGGGTGATGGA
ATAGCAGCCCTCGGCAAGAAAGATCATCTAGGAAAGTGGTCTGCGTCTCTTCTCAGTTCATTCCACAACGGGTGC
AACGACGCCGAAGTTGAGCAAATTCGTAAAGACCACCCTGGCGAGGCGGAATGCGTTCGAAACAACCGAGTCCTC
GGCGCCATTGCGGTCACGAGAGCTCTCGGCGATCACTGTTTCAAACTGTCCTCCATCTTTAGCGACCAGATATTT
TCACGCACCTATCCAGGCTTTTCTTTCTCAGCTACCAGTCTTGAAGAAATTATAGCACGTAATCTGACTCCACCC
TATGTGTCCAATCGTCCGGACGTCCAGCACGTCAATTTAAATAACGACCAATACCAAGAGACACGCTTGATCATG
TGTTCAGATGGCCTCGTCGACTTGTACTTGGATCAGTCTGAATCCTTGACTCAAGAGCAGCTACCCGAGATCTGG
CTCAGAGCTCTCGACAAACGCGACACATCGTCAAATACTGGGGATAACCTTGCTCTGGCTCTGCTTCGCCATGCC
CTCGGAGGGGAGGATGCTGAGACAGTATCGAGGAACATGACTTTGGAATATGAGGAAGCAAAGTGGATGGATGAC
ACAACTATCTTAGTACAGGGAATTTAG
Gene >AgabiH97|044660
ATGACTTCCTCCACCCAATCCACAAACCTGGGCTGGCCAGACCAAGAAACCATCTGCAAGTACACCTCTTACACA
GAACCCCTTCTCTCTTCAGAACTCGCTCGTCGAGCCTCTGCCACCACCCTCGGCGATACTCATCTCGTTTCCTTT
CAGCCCTCCCCCAACCCCCACTTTGCCAACCAAGACCGCTACGTCGTCCAGGACTGGCCTCTTCCCGACGGTCTC
TGGTCTTTTCGTGCCATCTTTGATGGTCCGTCTCTTTTCGTTTTTCACAACCTAAATCTGATCCCCCTACCACCA
GGTCACGGCGGTCATGCAACAGTCGATTACGCCACACAGGTCCTTCCGACCCAGCTCAAACAGCATCTCGAAGCT
AGATCACAGTCTCATCCTGACTATATATCCCAGCTCCTCCATGATACCATTGTTAATTTTGACGAAAGTCTGAAG
CGCGACCTTCTTGCCATTCTTCCCGACGTCGACGTTATTGCTCAGATGACCAACGACAAACTCCATACCCTGGTT
GGCGACCTTCAAGCCTCGGAAGACAGCGACATGGTCCTCAAGCGATGCATGCATGGCACCACCGCTCTCATCGCT
CTCTTTGATCCTCCCAAGCGTAACCTGTGGGTTGCTACTCTGGGTGATGGAATAGCAGGTATGTCCGTCTATATT
CCCCATCTTCCGTCTTCACATCCACTCCACCAAGCCCTCGGCAAGAAAGATCATCTAGGAAAGTGGTCTGCGTCT
CTTCTCAGTTCATTCCACAACGGGTGCAACGACGCCGAAGTTGAGCAAATTCGTAAAGACCACCCTGGCGAGGCG
GAATGCGTTCGAAACAACCGAGTCCTCGGCGCCATTGCGGTCACGAGAGGTTCATTTCTATTTTATTTCATCCGG
GTCCCGCCATTTCTCAAAAAAAGATGATAGCTCTCGGCGATCACTGTTTCAAACTGTCCTCCATCTTTAGCGACC
AGATATTTTCACGCACCTATCCAGGCTTTTCTTTCTCAGCTACCAGTCTTGAAGAAATTATAGCACGTAATCTGA
CTCCACCCTATGTGTCCAATCGTCCGGACGTCCAGCACGTCAATTTAAATAACGACCAATACCAAGAGACACGCT
TGATCATGTGTTCAGATGGCCTCGTCGACTTGTACTTGGATCAGTCTGAATCCTTGACTCAAGAGCAGCTACCCG
AGATCTGGCTCAGAGCTCTCGACAAACGCGACACATCGTCAAATACTGGGGATAACCTTGCTCTGGCTCTGCTTC
GCCATGCCCTCGGAGGGGAGGATGCTGAGACAGTATCGAGGAACATGACTTTGGAATATGAGGAAGCAAAGTGGA
TGGATGACACAACTATCTTAGTACAGGGAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail