Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044650
Gene name
Locationscaffold_2:1527871..1529382
Strand-
Gene length (bp)1511
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies) 3.7E-32 176 275
PF12874 zf-met Zinc-finger of C2H2 type 2.0E-09 72 94
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 5.9E-08 71 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 6 450 2.0E-77
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 1 450 2.0E-58
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 176 356 6.0E-49
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 7 360 8.0E-47
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 176 356 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 6 450 2.0E-77
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 1 450 2.0E-58
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 176 356 6.0E-49
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 7 360 8.0E-47
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 176 356 1.0E-46
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 7 450 6.0E-42
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 176 359 3.0E-37
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 176 307 3.0E-37
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 7 102 1.0E-19
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 6 102 1.0E-17
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 7 102 1.0E-17
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 7 117 8.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044650
MDNQPAFTCLSCSIAFLSPEEQRDHYKSDHHRYNMKRRVAGLPPVSVSVFNQKVLDRKTETAIMSSTRGSICEVC
NKVYTTENSYRSHLQSKKHKENELRPVPRSKPVSERPEEQQLPTTDLQENVPEVKKEEVGVVETKLAALTVDEEG
SPEEEINRTIDEKIAAARARLSPSHCLFCPHQSSDLADNLTHMSSSHSFFIPDADYLVDLPGLITYLGEKIAVGN
ICIYCNDKGKEFRSLEAVRKHMVDKSHCKITYESESDRLEVSDYYDFTSSYPDTQHKKKKQIREDQEWEDVEGGD
ADADEIVDEEMSGSEEDSEELPDTQITYGDSHLELVLPSGARIGHRSLKRYYDQSFPAAPRGGKAEDPNSGAAFV
RRLLADKNSALVPRKGGFGAFGAGTDVIKARNRGEAREAGRHVREFRDQKRREDFKTKVGFIHNHQKHFRDPLLQ
*
Coding >AgabiH97|044650
ATGGACAACCAACCCGCATTCACTTGCCTATCATGTTCTATCGCTTTCCTCTCGCCAGAGGAACAGCGTGACCAT
TACAAGTCTGATCACCATCGCTACAATATGAAGCGTCGAGTGGCGGGACTACCGCCCGTTAGTGTTTCTGTATTC
AATCAGAAAGTGTTGGATCGCAAAACAGAAACTGCCATTATGAGCTCTACGAGAGGCTCGATCTGTGAGGTTTGC
AATAAAGTCTATACAACCGAAAACTCGTATCGTTCCCATCTGCAATCTAAAAAGCACAAAGAAAATGAATTGCGT
CCTGTCCCTCGATCTAAACCAGTATCCGAACGTCCTGAAGAGCAGCAGCTTCCCACTACAGACCTCCAGGAAAAT
GTTCCAGAGGTGAAGAAAGAAGAAGTTGGGGTTGTAGAGACGAAACTTGCTGCTCTCACTGTAGATGAAGAAGGG
TCGCCAGAAGAGGAAATCAACCGTACCATAGACGAAAAGATCGCAGCCGCTCGTGCTAGACTGTCTCCCTCTCAC
TGTCTATTCTGCCCTCATCAATCTTCCGACCTCGCAGACAACTTGACCCATATGTCTTCTTCCCATTCATTCTTC
ATCCCCGATGCTGATTACCTTGTCGACCTTCCCGGTCTGATCACGTATCTCGGCGAGAAAATTGCTGTCGGTAAT
ATTTGCATCTATTGCAACGACAAAGGAAAAGAGTTTCGGTCGCTGGAAGCAGTTCGCAAACACATGGTTGATAAA
AGCCATTGTAAAATCACATATGAAAGCGAATCGGACCGCCTCGAAGTCTCGGATTATTACGACTTTACAAGTTCA
TATCCCGATACTCAGCACAAGAAGAAAAAACAAATCAGGGAGGATCAGGAATGGGAAGACGTTGAAGGAGGAGAT
GCAGATGCAGATGAGATCGTGGATGAAGAAATGTCAGGATCAGAAGAGGATTCAGAGGAGCTACCGGACACTCAG
ATCACATATGGCGACTCCCACCTTGAGCTCGTGCTGCCTTCCGGTGCACGCATCGGGCATCGATCACTGAAGCGC
TATTATGATCAATCATTCCCTGCAGCGCCTAGGGGAGGGAAAGCAGAAGACCCCAATTCTGGTGCAGCTTTTGTT
CGCCGATTATTAGCGGACAAGAATTCGGCCTTGGTTCCCCGCAAAGGTGGATTTGGAGCCTTTGGGGCTGGAACG
GATGTTATCAAGGCGCGGAATCGTGGTGAAGCTAGAGAGGCCGGTCGCCACGTTCGTGAATTCCGTGATCAAAAA
CGGCGCGAAGACTTCAAGACCAAAGTTGGCTTCATTCATAATCACCAGAAGCACTTTAGAGATCCCTTGCTTCAA
TGA
Transcript >AgabiH97|044650
ATGGACAACCAACCCGCATTCACTTGCCTATCATGTTCTATCGCTTTCCTCTCGCCAGAGGAACAGCGTGACCAT
TACAAGTCTGATCACCATCGCTACAATATGAAGCGTCGAGTGGCGGGACTACCGCCCGTTAGTGTTTCTGTATTC
AATCAGAAAGTGTTGGATCGCAAAACAGAAACTGCCATTATGAGCTCTACGAGAGGCTCGATCTGTGAGGTTTGC
AATAAAGTCTATACAACCGAAAACTCGTATCGTTCCCATCTGCAATCTAAAAAGCACAAAGAAAATGAATTGCGT
CCTGTCCCTCGATCTAAACCAGTATCCGAACGTCCTGAAGAGCAGCAGCTTCCCACTACAGACCTCCAGGAAAAT
GTTCCAGAGGTGAAGAAAGAAGAAGTTGGGGTTGTAGAGACGAAACTTGCTGCTCTCACTGTAGATGAAGAAGGG
TCGCCAGAAGAGGAAATCAACCGTACCATAGACGAAAAGATCGCAGCCGCTCGTGCTAGACTGTCTCCCTCTCAC
TGTCTATTCTGCCCTCATCAATCTTCCGACCTCGCAGACAACTTGACCCATATGTCTTCTTCCCATTCATTCTTC
ATCCCCGATGCTGATTACCTTGTCGACCTTCCCGGTCTGATCACGTATCTCGGCGAGAAAATTGCTGTCGGTAAT
ATTTGCATCTATTGCAACGACAAAGGAAAAGAGTTTCGGTCGCTGGAAGCAGTTCGCAAACACATGGTTGATAAA
AGCCATTGTAAAATCACATATGAAAGCGAATCGGACCGCCTCGAAGTCTCGGATTATTACGACTTTACAAGTTCA
TATCCCGATACTCAGCACAAGAAGAAAAAACAAATCAGGGAGGATCAGGAATGGGAAGACGTTGAAGGAGGAGAT
GCAGATGCAGATGAGATCGTGGATGAAGAAATGTCAGGATCAGAAGAGGATTCAGAGGAGCTACCGGACACTCAG
ATCACATATGGCGACTCCCACCTTGAGCTCGTGCTGCCTTCCGGTGCACGCATCGGGCATCGATCACTGAAGCGC
TATTATGATCAATCATTCCCTGCAGCGCCTAGGGGAGGGAAAGCAGAAGACCCCAATTCTGGTGCAGCTTTTGTT
CGCCGATTATTAGCGGACAAGAATTCGGCCTTGGTTCCCCGCAAAGGTGGATTTGGAGCCTTTGGGGCTGGAACG
GATGTTATCAAGGCGCGGAATCGTGGTGAAGCTAGAGAGGCCGGTCGCCACGTTCGTGAATTCCGTGATCAAAAA
CGGCGCGAAGACTTCAAGACCAAAGTTGGCTTCATTCATAATCACCAGAAGCACTTTAGAGATCCCTTGCTTCAA
TGA
Gene >AgabiH97|044650
ATGGACAACCAACCCGCATTCACTTGCCTATCATGTTCTATCGCTTTCCTCTCGCCAGAGGAACAGCGTAAGTCT
CCTATCATGTTCAATATACACCAATCTGACGCTCTTTTCAGGTGACCATTACAAGTCTGATCACCATCGCTACAA
TATGAAGCGTCGAGTGGCGGGACTACCGCCCGTTAGTGTTTCTGTATTCAATCAGAAAGTGTTGGATCGCAAAAC
AGAAACTGCCATTATGAGCTCTACGAGAGGCTCGATCTGTGAGGTTTGCAAGTGAGTCATCTCCGGCTCCGCCCC
ACATCTCAAGATTCTCAAAGTTGCTCCACAGTAAAGTCTATACAACCGAAAACTCGTATCGTTCCCATCTGCAAT
CTAAAAAGCACAAAGAAAATGAATTGCGTCCTGTCCCTCGATCTAAACCAGTATCCGAACGTCCTGAAGAGCAGC
AGCTTCCCACTACAGACCTCCAGGAAAATGTTCCAGAGGTGAAGAAAGAAGAAGTTGGGGTTGTAGAGACGAAAC
TTGCTGCTCTCACTGTAGATGAAGAAGGGTCGCCAGAAGAGGAAATCAACCGTACCATAGACGAAAAGATCGCAG
CCGCTCGTGCTAGACTGTCTCCCTCTCACTGTCTATTCTGCCCTCATCAATCTTCCGACCTCGCAGACAACTTGA
CCCATATGTCTTCTTCCCATTCATTCTTCATCCCCGATGCTGATTACCTTGTCGACCTTCCCGGTCTGATCACGT
ATCTCGGCGAGAAAATTGCTGTCGGTAATATTTGCATCTATTGCAACGACAAAGGAAAAGAGTTTCGGTCGCTGG
AAGCAGTTCGCAAACACATGGTTGATAAAAGCCATTGTAAAATCACATATGAAAGCGAATCGGACCGCCTCGAAG
TCTCGGATTATTACGACTTTACAAGTTCATATCCCGATACTCAGCACAAGAAGAAAAAACAAATCAGGGAGGATC
AGGAATGGGAAGACGTTGAAGGAGGAGATGCAGATGCAGATGAGATCGTGGATGAAGAAATGTCAGGATCAGAAG
AGGATTCAGAGGAGCTACCGGACACTCAGATCACATATGGCGACTCCCACCTTGAGCTCGTGCTGCCTTCCGGTG
CACGCATCGGGCATCGATCACTGAAGCGCTATTATGATCAATCATTCCCTGCAGCGCCTAGGGGAGGGAAAGCAG
AAGACCCCAATTCTGGTGCAGCTTTTGTTCGCCGATTATTAGCGGACAAGAATTCGGCCTTGGTTCCCCGCAAAG
GTGGATTTGGAGCCTTTGGGGCTGGAACGGATGTTATCAAGGCGCGGAATCGTGGTGAAGCTAGAGAGGCCGGTC
GCCACGTTCGTGAATTCCGTGATCAAAAACGGCGCGAAGACTTCAAGACCAAAGTTGGCTTCATTCATAATCACC
AGAAGCACTTTAGAGATCCCTGTGCGTATATCCCTCCCTCCCTCTTTAATTCATACACTCATCATCACTTTGCAG
TGCTTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail