Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044380
Gene name
Locationscaffold_2:1451034..1453647
Strand-
Gene length (bp)2613
Transcript length (bp)2295
Coding sequence length (bp)2295
Protein length (aa) 765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 5.6E-12 321 375
PF13639 zf-RING_2 Ring finger domain 7.3E-10 321 375
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.6E-07 322 374
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 2.5E-06 316 378
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-05 322 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 30 412 8.0E-81
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 23 422 9.0E-81
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 23 422 2.0E-78
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 23 386 4.0E-78
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 23 384 7.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 30 412 8.0E-81
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 23 422 9.0E-81
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 23 422 2.0E-78
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 23 386 4.0E-78
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 23 384 7.0E-78
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 23 384 1.0E-77
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 23 412 2.0E-76
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 31 387 1.0E-73
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 31 387 2.0E-73
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 31 380 5.0E-67
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 31 380 8.0E-66
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 26 408 2.0E-60
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 52 378 1.0E-30
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 52 378 3.0E-30
sp|Q75CC8|HRD1_ASHGO ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HRD1 PE=3 SV=2 53 399 2.0E-22
sp|Q08109|HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRD1 PE=1 SV=1 236 380 2.0E-14
sp|Q8VYC8|RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana GN=RIN2 PE=1 SV=1 62 376 7.0E-14
sp|Q8W4Q5|RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana GN=RIN3 PE=1 SV=2 56 376 3.0E-11
sp|A8WWR3|HRDL1_CAEBR E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis briggsae GN=hrdl-1 PE=3 SV=1 243 382 1.0E-08
sp|P90859|HRDL1_CAEEL E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis elegans GN=hrdl-1 PE=1 SV=2 243 386 5.0E-08
sp|P30631|YOUD_CAEEL Uncharacterized RING finger protein ZK637.14 OS=Caenorhabditis elegans GN=ZK637.14 PE=3 SV=2 319 378 7.0E-08
sp|Q7ZWF4|RN145_DANRE RING finger protein 145 OS=Danio rerio GN=rnf145 PE=2 SV=1 283 396 9.0E-08
sp|Q5SWK7|RN145_MOUSE RING finger protein 145 OS=Mus musculus GN=Rnf145 PE=2 SV=1 207 419 5.0E-07
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 309 390 8.0E-07
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 319 378 1.0E-06
sp|Q7TPV2|DZIP3_MOUSE E3 ubiquitin-protein ligase DZIP3 OS=Mus musculus GN=Dzip3 PE=1 SV=2 322 381 2.0E-06
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 298 412 4.0E-06
sp|Q86Y13|DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens GN=DZIP3 PE=1 SV=2 322 392 7.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 298 387 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0046872 metal ion binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0046914 transition metal ion binding No
GO:0005575 cellular_component No
GO:0140535 intracellular protein-containing complex No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1990234 transferase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0030163 protein catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0032991 protein-containing complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0044260 cellular macromolecule metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0004842 ubiquitin-protein transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0010498 proteasomal protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0005515 protein binding No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0140513 nuclear protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19
2 64 86 22
3 121 138 17
4 158 180 22
5 195 217 22
6 258 280 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044380
MPPLQQLLRHGSNRVLRSALSHRVQLYFLVSLVALSAVVFNALRNYSNFYSVAISLSKSSRSVLVLANFAVLLAL
LGAHIVQRIFFGALRANEVERLYDRLWFFITESLLAFTIFRDEFDIGFVLMFGFLLFVKSFHWLSSDRVEWMDQQ
QYPGPPVLFHIRMISLFSILWLVDFIMFVIAMDHTIAYGVGGMVLFASEYGILMASLMNTVFKYLLFAYDLRRAG
RRGGENAPPWENKSMWVFYIELTTDFLKLTTYLIFFIIIITFYGLPLNIVRDVYITARSFITRLRALHRYQTATR
NMDQRYPNATEAELAATSDRTCIICREDMVPAVQGQPPVSDGPNVTPKKLPCGHIFHFYCLRSWLERQQSCPTCR
QTVLEPNTPRRPANGPPVAPQQQGNAPAAQPGNDAPAVNNPIGNPLGLLGRILGPPGLGAERNPLAPPRVAQNMG
ANGGNNPIVIEYTIQYRTPQNNAQNTPVNLRPVQPLEGLPGPNGWQQWPGRRDNDNEARIPPGPTREATSTTPSG
APAPNAVPTNAQDTAGESHGSENPRAAAALAALRRLNGNSSSEGNEPPSRDTSGLTTSSDLQTDTPPSYSASSTV
PQFIPLFDLSQSRSAQGSLPCANGTTLPQTFSANTEPSPASHPGDFMTQLPRHITDTQLSLMDRLTRETIDERLR
ILERVSGTAYGCVEDLLRLRSALPVTDTLHAGHTSDRGPDHVNSGHRAESANENLDRSPEVLDKGKGVDRSLGPE
PVEGLSEVADAGNS*
Coding >AgabiH97|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTTTCCAAAAGCAGTCGCAGTGTTCTCGTTCTCGCCAATTTTGCTGTGCTTCTGGCCCTG
TTGGGTGCACACATTGTTCAGCGTATCTTCTTTGGTGCTCTTCGCGCGAACGAGGTCGAGCGGCTTTATGACCGA
CTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTTACCATTTTCCGTGATGAATTCGACATAGGTTTCGTCCTC
ATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTCGAGTGATCGCGTTGAATGGATGGACCAACAG
CAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGGATTTC
ATAATGTTCGTCATCGCAATGGATCACACGATTGCGTATGGTGTTGGTGGTATGGTTTTATTTGCCAGCGAATAT
GGAATTCTCATGGCCAGCCTCATGAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTACGGCGCGCAGGG
CGTCGTGGAGGAGAAAACGCACCTCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGAT
TTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCATCATAACGTTCTACGGTCTTCCTCTCAACATAGTT
CGAGATGTCTACATCACTGCGCGCTCCTTTATCACCCGCTTACGTGCATTACACCGCTACCAGACGGCGACCCGT
AATATGGATCAGCGTTATCCGAATGCTACTGAAGCTGAGTTAGCTGCCACTTCCGATCGTACTTGTATCATCTGT
CGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGTAAGCGATGGACCAAATGTCACTCCCAAAAAACTT
CCTTGTGGGCACATCTTCCATTTCTATTGCCTTCGTTCTTGGCTGGAAAGGCAGCAAAGCTGTCCAACATGTCGT
CAAACTGTGCTCGAGCCGAACACACCTCGACGACCGGCCAATGGACCCCCAGTCGCACCGCAGCAACAGGGAAAT
GCTCCAGCTGCTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAATCCATTAGGGCTCCTTGGA
CGCATCCTTGGTCCCCCCGGGCTCGGTGCCGAGCGCAACCCTTTGGCTCCCCCTCGCGTTGCGCAAAATATGGGT
GCGAATGGTGGTAACAATCCAATAGTAATTGAGTATACCATTCAATATCGAACTCCGCAGAATAATGCACAGAAT
ACGCCAGTTAATTTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGACCAAACGGTTGGCAACAATGGCCAGGT
CGCCGCGACAATGACAATGAGGCACGGATCCCACCAGGTCCAACTCGTGAAGCTACCTCTACAACGCCATCCGGA
GCGCCAGCGCCTAATGCAGTGCCTACGAATGCGCAGGATACAGCTGGTGAAAGTCATGGTTCTGAGAATCCTAGA
GCCGCTGCTGCACTCGCGGCACTGCGCCGTTTGAACGGGAACTCCTCTTCAGAGGGGAATGAACCTCCATCTCGT
GATACCAGCGGACTGACTACGTCTTCGGATCTTCAGACAGATACACCACCTTCGTATTCCGCTTCCTCGACGGTT
CCACAGTTCATTCCCCTATTTGATCTCTCTCAATCGCGATCAGCTCAGGGATCTTTACCGTGTGCAAATGGAACA
ACGCTCCCCCAGACATTCTCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGGAGATTTCATGACCCAGCTT
CCTAGGCACATCACTGACACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACTATCGACGAGCGCCTCCGC
ATTCTAGAACGCGTGTCAGGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTTCGGAGCGCCCTTCCCGTG
ACAGACACCTTGCATGCCGGACATACCTCAGATAGAGGACCCGACCATGTGAATAGCGGACATAGGGCCGAAAGT
GCCAACGAAAATCTTGACCGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGATCGGAGTCTCGGTCCTGAG
CCGGTCGAAGGCTTGTCCGAAGTGGCAGATGCAGGCAATTCTTAA
Transcript >AgabiH97|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTTTCCAAAAGCAGTCGCAGTGTTCTCGTTCTCGCCAATTTTGCTGTGCTTCTGGCCCTG
TTGGGTGCACACATTGTTCAGCGTATCTTCTTTGGTGCTCTTCGCGCGAACGAGGTCGAGCGGCTTTATGACCGA
CTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTTACCATTTTCCGTGATGAATTCGACATAGGTTTCGTCCTC
ATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTCGAGTGATCGCGTTGAATGGATGGACCAACAG
CAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGGATTTC
ATAATGTTCGTCATCGCAATGGATCACACGATTGCGTATGGTGTTGGTGGTATGGTTTTATTTGCCAGCGAATAT
GGAATTCTCATGGCCAGCCTCATGAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTACGGCGCGCAGGG
CGTCGTGGAGGAGAAAACGCACCTCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGAT
TTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCATCATAACGTTCTACGGTCTTCCTCTCAACATAGTT
CGAGATGTCTACATCACTGCGCGCTCCTTTATCACCCGCTTACGTGCATTACACCGCTACCAGACGGCGACCCGT
AATATGGATCAGCGTTATCCGAATGCTACTGAAGCTGAGTTAGCTGCCACTTCCGATCGTACTTGTATCATCTGT
CGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGTAAGCGATGGACCAAATGTCACTCCCAAAAAACTT
CCTTGTGGGCACATCTTCCATTTCTATTGCCTTCGTTCTTGGCTGGAAAGGCAGCAAAGCTGTCCAACATGTCGT
CAAACTGTGCTCGAGCCGAACACACCTCGACGACCGGCCAATGGACCCCCAGTCGCACCGCAGCAACAGGGAAAT
GCTCCAGCTGCTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAATCCATTAGGGCTCCTTGGA
CGCATCCTTGGTCCCCCCGGGCTCGGTGCCGAGCGCAACCCTTTGGCTCCCCCTCGCGTTGCGCAAAATATGGGT
GCGAATGGTGGTAACAATCCAATAGTAATTGAGTATACCATTCAATATCGAACTCCGCAGAATAATGCACAGAAT
ACGCCAGTTAATTTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGACCAAACGGTTGGCAACAATGGCCAGGT
CGCCGCGACAATGACAATGAGGCACGGATCCCACCAGGTCCAACTCGTGAAGCTACCTCTACAACGCCATCCGGA
GCGCCAGCGCCTAATGCAGTGCCTACGAATGCGCAGGATACAGCTGGTGAAAGTCATGGTTCTGAGAATCCTAGA
GCCGCTGCTGCACTCGCGGCACTGCGCCGTTTGAACGGGAACTCCTCTTCAGAGGGGAATGAACCTCCATCTCGT
GATACCAGCGGACTGACTACGTCTTCGGATCTTCAGACAGATACACCACCTTCGTATTCCGCTTCCTCGACGGTT
CCACAGTTCATTCCCCTATTTGATCTCTCTCAATCGCGATCAGCTCAGGGATCTTTACCGTGTGCAAATGGAACA
ACGCTCCCCCAGACATTCTCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGGAGATTTCATGACCCAGCTT
CCTAGGCACATCACTGACACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACTATCGACGAGCGCCTCCGC
ATTCTAGAACGCGTGTCAGGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTTCGGAGCGCCCTTCCCGTG
ACAGACACCTTGCATGCCGGACATACCTCAGATAGAGGACCCGACCATGTGAATAGCGGACATAGGGCCGAAAGT
GCCAACGAAAATCTTGACCGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGATCGGAGTCTCGGTCCTGAG
CCGGTCGAAGGCTTGTCCGAAGTGGCAGATGCAGGCAATTCTTAA
Gene >AgabiH97|044380
ATGCCTCCTCTCCAACAACTCCTCCGCCATGGCTCAAATCGTGTCCTCCGCTCCGCTCTCTCCCATCGCGTCCAG
CTCTATTTCCTCGTCTCCCTCGTCGCTCTCTCCGCCGTCGTCTTCAATGCTCTCCGCAACTATAGTAACTTCTAT
TCAGTCGCCATATCGCTTTCCAAAAGCAGTCGCAGTGTTCTCGTGCGTTTCATAACTGCACCTCGAGGTGCTGTT
TAACCCTTTTCCAGGTTCTCGCCAATTTTGCTGTGCTTCTGGCCCTGTTGGGTGCACACATTGTTCAGCGTATCT
TCTTTGGTGCTCTTCGCGCGAACGAGGTCGAGGTGCGTTTCCGACCACTCGCACCAGTCAATCATTCATAGTAAC
CGCTCGTCTCCTTCAGCGGCTTTATGACCGACTCTGGTTCTTCATTACGGAGTCCCTTTTGGCGTTTACCATTTT
CCGTGATGAATTCGACATAGGTTTCGTCCTCATGTTCGGGTTTTTGCTCTTCGTCAAGTCTTTTCACTGGCTGTC
GAGTGATCGCGTTGAATGGGTAATTACTAGCTTATTCACGGCTACCCCTTTTTGACTGTGCATCCTAGATGGACC
AACAGCAGTATCCCGGTCCGCCAGTACTCTTTCACATACGGATGATATCATTGTTTTCGATCCTGTGGCTCGTGG
ATTTCATAATGTTCGTCATCGCAATGGATCACACGATTGCGTATGGTGTTGGTGGTATGGTTTTATTTGCCAGCG
AAGTTGGTTTGTCTTTGAGGAGTTCATTCAAACATCTGACAATTCCTAATAGTATGGAATTCTCATGGCCAGCCT
CATGAACACCGTTTTCAAATATCTTCTCTTCGCTTATGATTTACGGCGCGCAGGGCGTCGTGGAGGAGAAAACGC
ACCTCCTTGGGAAAATAAATCGATGTGGGTGTTCTATATCGAACTGACCACAGGTGAGTAGTGCCCGCTCTCCTA
CATATCTTAATCGTTCACAAAATTGGCGCTAGATTTCCTCAAGTTGACGACTTATCTCATCTTTTTCATCATCAT
CATAACGTTCTACGGTCTTCCTCTCAACATAGTTCGAGATGTCTACATCACTGCGCGCTCCTTTATCACCCGCTT
ACGTGCATTACACCGCTACCAGACGGCGACCCGTAATATGGATCAGCGTTATCCGAATGCTACTGAAGCTGAGTT
AGCTGCCACTTCCGATCGTACTTGTATCATCTGTCGCGAAGACATGGTGCCAGCTGTTCAAGGTCAACCTCCAGT
AAGCGATGGACCAAATGTCACTCCCAAAAAACTTCCTTGTGGGCACATCTTCCATTTCTATTGCCTTCGTTCTTG
GCTGGAAAGGCAGCAAAGCTGTCCAACATGGTCTGTACTGACTTTTCATCTCCGTCGTGCCATCAATTGATCACT
TTGATAATTTCCAGTCGTCAAACTGTGCTCGAGCCGAACACACCTCGACGACCGGCCAATGGACCCCCAGTCGCA
CCGCAGCAACAGGGAAATGCTCCAGCTGCTCAACCTGGAAATGATGCCCCGGCCGTTAATAATCCAATAGGGAAT
CCATTAGGGCTCCTTGGACGCATCCTTGGTCCCCCCGGGCTCGGTGCCGAGCGCAACCCTTTGGCTCCCCCTCGC
GTTGCGCAAAATATGGGTGCGAATGGTGGTAACAATCCAATAGTAATTGAGTATACCATTCAATATCGAACTCCG
CAGAATAATGCACAGAATACGCCAGTTAATTTGCGTCCTGTACAACCTCTGGAGGGACTTCCGGGACCAAACGGT
TGGCAACAATGGCCAGGTCGCCGCGACAATGACAATGAGGCACGGATCCCACCAGGTCCAACTCGTGAAGCTACC
TCTACAACGCCATCCGGAGCGCCAGCGCCTAATGCAGTGCCTACGAATGCGCAGGATACAGCTGGTGAAAGTCAT
GGTTCTGAGAATCCTAGAGCCGCTGCTGCACTCGCGGCACTGCGCCGTTTGAACGGGAACTCCTCTTCAGAGGGG
AATGAACCTCCATCTCGTGATACCAGCGGACTGACTACGTCTTCGGATCTTCAGACAGATACACCACCTTCGTAT
TCCGCTTCCTCGACGGTTCCACAGTTCATTCCCCTATTTGATCTCTCTCAATCGCGATCAGCTCAGGGATCTTTA
CCGTGTGCAAATGGAACAACGCTCCCCCAGACATTCTCGGCAAATACTGAGCCCTCACCTGCGTCACACCCAGGA
GATTTCATGACCCAGCTTCCTAGGCACATCACTGACACTCAGCTGTCGCTCATGGACAGGTTGACCCGAGAAACT
ATCGACGAGCGCCTCCGCATTCTAGAACGCGTGTCAGGAACCGCCTATGGCTGTGTGGAAGACTTGCTCAGACTT
CGGAGCGCCCTTCCCGTGACAGACACCTTGCATGCCGGACATACCTCAGATAGAGGACCCGACCATGTGAATAGC
GGACATAGGGCCGAAAGTGCCAACGAAAATCTTGACCGTTCTCCTGAAGTTTTGGACAAGGGTAAAGGAGTTGAT
CGGAGTCTCGGTCCTGAGCCGGTCGAAGGCTTGTCCGAAGTGGCAGATGCAGGCAATTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail