Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044370
Gene name
Locationscaffold_2:1450057..1450940
Strand+
Gene length (bp)883
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09424 YqeY Yqey-like protein 1.6E-24 38 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7TN35|AIM41_VANPO Altered inheritance of mitochondria protein 41, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM41 PE=3 SV=1 42 190 1.0E-11
sp|Q6CRS3|AIM41_KLULA Altered inheritance of mitochondria protein 41, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM41 PE=3 SV=1 42 156 1.0E-08
sp|C4XYS2|AIM41_CLAL4 Altered inheritance of mitochondria protein 41, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM41 PE=3 SV=1 42 157 1.0E-08
sp|C5DXN2|AIM41_ZYGRC Altered inheritance of mitochondria protein 41, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM41 PE=3 SV=1 42 155 7.0E-08
sp|C6Y4B8|YA8O_SCHPO Uncharacterized protein C22F3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F3.15 PE=2 SV=1 15 129 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7TN35|AIM41_VANPO Altered inheritance of mitochondria protein 41, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM41 PE=3 SV=1 42 190 1.0E-11
sp|Q6CRS3|AIM41_KLULA Altered inheritance of mitochondria protein 41, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM41 PE=3 SV=1 42 156 1.0E-08
sp|C4XYS2|AIM41_CLAL4 Altered inheritance of mitochondria protein 41, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM41 PE=3 SV=1 42 157 1.0E-08
sp|C5DXN2|AIM41_ZYGRC Altered inheritance of mitochondria protein 41, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM41 PE=3 SV=1 42 155 7.0E-08
sp|C6Y4B8|YA8O_SCHPO Uncharacterized protein C22F3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F3.15 PE=2 SV=1 15 129 2.0E-07
sp|C8ZGX0|AIM41_YEAS8 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM41 PE=3 SV=1 41 167 4.0E-07
sp|A6ZP58|AIM41_YEAS7 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM41 PE=3 SV=1 41 167 4.0E-07
sp|Q12032|AIM41_YEAST Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM41 PE=1 SV=1 42 167 1.0E-06
sp|B5VS96|AIM41_YEAS6 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|C7GWG7|AIM41_YEAS2 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|B3LJN9|AIM41_YEAS1 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|A5DKQ3|AIM41_PICGU Altered inheritance of mitochondria protein 41, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM41 PE=3 SV=2 42 172 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 22.41 10.52 34.29
Initials Initials knots 25.45 12.11 38.78
Pileal_Stipeal_center Stage I stipe center 40.43 20.50 60.35
Pileal_Stipeal_shell Stage I stipe shell 71.22 38.79 103.64
DIF_stipe_center Stage II stipe center 55.64 29.52 81.75
DIF_stipe_shell Stage II stipe shell 31.89 15.64 48.15
DIF_stipe_skin Stage II stipe skin 35.13 17.45 52.81
DIF_cap_skin Stage II cap skin 70.64 38.37 102.90
DIF_cap_tissue Stage II cap tissue 81.58 45.10 118.06
DIF_gill_tissue Stage II gill tissue 77.84 43.05 112.62
YFB_stipe_center Young fruiting body stipe center 34.89 17.36 52.42
YFB_stipe_shell Young fruiting body stipe shell 29.79 14.33 45.26
YFB_stipe_skin Young fruiting body stipe skin 30.93 15.05 46.80
YFB_cap_skin Young fruiting body cap skin 59.27 31.73 86.81
YFB_cap_tissue Young fruiting body cap tissue 70.73 38.79 102.67
YFB_gill_tissue Young fruiting body gill tissue 57.94 30.89 84.99
YFB_veil Young fruiting body veil 75.56 40.92 110.21

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.244377 no
Casing YFB_stipe_shell 0.542444 no
Casing YFB_stipe_skin 0.458582 no
Casing YFB_cap_skin 0.001625 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.002951 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.834887 no
Casing Pileal_Stipeal_center 0.084017 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.003365 yes
Casing DIF_stipe_shell 0.389002 no
Casing DIF_stipe_skin 0.238649 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.008457 yes
DIF_gill_tissue YFB_stipe_shell 0.001625 yes
DIF_gill_tissue YFB_stipe_skin 0.002951 yes
DIF_gill_tissue YFB_cap_skin 0.486632 no
DIF_gill_tissue YFB_cap_tissue 0.859086 no
DIF_gill_tissue YFB_gill_tissue 0.448765 no
DIF_gill_tissue YFB_veil 0.962009 no
YFB_stipe_center YFB_stipe_shell 0.779887 no
YFB_stipe_center YFB_stipe_skin 0.837605 no
YFB_stipe_center YFB_cap_skin 0.117477 no
YFB_stipe_center YFB_cap_tissue 0.025711 yes
YFB_stipe_center YFB_gill_tissue 0.146322 no
YFB_stipe_center YFB_veil 0.013485 yes
YFB_stipe_shell YFB_stipe_skin 0.956338 no
YFB_stipe_shell YFB_cap_skin 0.038942 yes
YFB_stipe_shell YFB_cap_tissue 0.008457 yes
YFB_stipe_shell YFB_gill_tissue 0.049257 yes
YFB_stipe_shell YFB_veil 0.004160 yes
YFB_stipe_skin YFB_cap_skin 0.055979 no
YFB_stipe_skin YFB_cap_tissue 0.011041 yes
YFB_stipe_skin YFB_gill_tissue 0.071968 no
YFB_stipe_skin YFB_veil 0.006387 yes
YFB_cap_skin YFB_cap_tissue 0.696079 no
YFB_cap_skin YFB_gill_tissue 0.970246 no
YFB_cap_skin YFB_veil 0.556928 no
YFB_cap_tissue YFB_gill_tissue 0.656575 no
YFB_cap_tissue YFB_veil 0.909299 no
YFB_gill_tissue YFB_veil 0.519162 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.462332 no
Initials YFB_stipe_shell 0.784631 no
Initials YFB_stipe_skin 0.712265 no
Initials YFB_cap_skin 0.008457 yes
Initials YFB_cap_tissue 0.001140 yes
Initials YFB_gill_tissue 0.010412 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.213894 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.013485 yes
Initials DIF_stipe_shell 0.646982 no
Initials DIF_stipe_skin 0.458171 no
Initials DIF_cap_skin 0.001625 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.031800 yes
Pileal_Stipeal_center YFB_stipe_center 0.779108 no
Pileal_Stipeal_center YFB_stipe_shell 0.483189 no
Pileal_Stipeal_center YFB_stipe_skin 0.549300 no
Pileal_Stipeal_center YFB_cap_skin 0.288693 no
Pileal_Stipeal_center YFB_cap_tissue 0.072685 no
Pileal_Stipeal_center YFB_gill_tissue 0.339307 no
Pileal_Stipeal_center YFB_veil 0.042475 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.070681 no
Pileal_Stipeal_center DIF_stipe_center 0.425392 no
Pileal_Stipeal_center DIF_stipe_shell 0.605922 no
Pileal_Stipeal_center DIF_stipe_skin 0.796404 no
Pileal_Stipeal_center DIF_cap_skin 0.076444 no
Pileal_Stipeal_center DIF_cap_tissue 0.022631 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.873422 no
Pileal_Stipeal_shell YFB_stipe_center 0.022369 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.009123 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.007439 yes
Pileal_Stipeal_shell YFB_cap_skin 0.689189 no
Pileal_Stipeal_shell YFB_cap_tissue 0.990332 no
Pileal_Stipeal_shell YFB_gill_tissue 0.646085 no
Pileal_Stipeal_shell YFB_veil 0.921853 no
Pileal_Stipeal_shell DIF_stipe_center 0.560709 no
Pileal_Stipeal_shell DIF_stipe_shell 0.006387 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.026710 yes
Pileal_Stipeal_shell DIF_cap_skin 0.988804 no
Pileal_Stipeal_shell DIF_cap_tissue 0.788652 no
DIF_stipe_center DIF_gill_tissue 0.363626 no
DIF_stipe_center YFB_stipe_center 0.190373 no
DIF_stipe_center YFB_stipe_shell 0.068270 no
DIF_stipe_center YFB_stipe_skin 0.083843 no
DIF_stipe_center YFB_cap_skin 0.919782 no
DIF_stipe_center YFB_cap_tissue 0.565575 no
DIF_stipe_center YFB_gill_tissue 0.948586 no
DIF_stipe_center YFB_veil 0.431613 no
DIF_stipe_center DIF_stipe_shell 0.098108 no
DIF_stipe_center DIF_stipe_skin 0.204470 no
DIF_stipe_center DIF_cap_skin 0.577701 no
DIF_stipe_center DIF_cap_tissue 0.285338 no
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.884156 no
DIF_stipe_shell YFB_stipe_shell 0.918111 no
DIF_stipe_shell YFB_stipe_skin 0.963451 no
DIF_stipe_shell YFB_cap_skin 0.052948 no
DIF_stipe_shell YFB_cap_tissue 0.008457 yes
DIF_stipe_shell YFB_gill_tissue 0.071041 no
DIF_stipe_shell YFB_veil 0.002525 yes
DIF_stipe_shell DIF_stipe_skin 0.873617 no
DIF_stipe_shell DIF_cap_skin 0.009446 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.008121 yes
DIF_stipe_skin YFB_stipe_center 0.991208 no
DIF_stipe_skin YFB_stipe_shell 0.768306 no
DIF_stipe_skin YFB_stipe_skin 0.827384 no
DIF_stipe_skin YFB_cap_skin 0.121717 no
DIF_stipe_skin YFB_cap_tissue 0.025205 yes
DIF_stipe_skin YFB_gill_tissue 0.155040 no
DIF_stipe_skin YFB_veil 0.012274 yes
DIF_stipe_skin DIF_cap_skin 0.023676 yes
DIF_stipe_skin DIF_cap_tissue 0.005671 yes
DIF_cap_skin DIF_gill_tissue 0.860321 no
DIF_cap_skin YFB_stipe_center 0.026955 yes
DIF_cap_skin YFB_stipe_shell 0.010093 yes
DIF_cap_skin YFB_stipe_skin 0.008121 yes
DIF_cap_skin YFB_cap_skin 0.711051 no
DIF_cap_skin YFB_cap_tissue 0.997380 no
DIF_cap_skin YFB_gill_tissue 0.666842 no
DIF_cap_skin YFB_veil 0.910194 no
DIF_cap_skin DIF_cap_tissue 0.774166 no
DIF_cap_tissue DIF_gill_tissue 0.937352 no
DIF_cap_tissue YFB_stipe_center 0.003365 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.387361 no
DIF_cap_tissue YFB_cap_tissue 0.767563 no
DIF_cap_tissue YFB_gill_tissue 0.350576 no
DIF_cap_tissue YFB_veil 0.892684 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044370
MLPTCRAFRFLNGSHVNFPKHSRAFSASLPVPQDLRVRIMNDIKLALKSKDSMTATTLRSILADIQAADKSHKDS
KIGEPAIRAFIARGISKRHDAASRYDQARRLDLASKERQEAEILQRMLPPALSDSRIDEILKQIIDSLPPSANRP
PLGQVFKAFYAQVDKSLVRPDVLKQRAQAALSISHTSTASTS*
Coding >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAATCCAAG
GATTCTATGACGGCGACTACGCTGCGGTCTATCCTTGCCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGC
AAAATTGGTGAACCTGCCATTAGGGCATTCATAGCAAGAGGTATTTCCAAGCGCCATGATGCCGCTTCACGGTAT
GATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCCACCT
GCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCGGCCT
CCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAAACAG
CGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG
Transcript >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAATCCAAG
GATTCTATGACGGCGACTACGCTGCGGTCTATCCTTGCCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGC
AAAATTGGTGAACCTGCCATTAGGGCATTCATAGCAAGAGGTATTTCCAAGCGCCATGATGCCGCTTCACGGTAT
GATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCCACCT
GCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCGGCCT
CCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAAACAG
CGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG
Gene >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGGTAAGAAGAATCATCCTACATGCAGCAACCGCGTTTGGCTCAACTTAAAC
CCAAATTTCCAATTCAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAAGTAAGAAGCACGCG
GTGCTCGTAGTGGTTCATATTCACGAACGTGCTAATGATTGTGGCAGTCCAAGGATTCTATGACGGCGACTACGC
TGCGGGTGAGCAATAGAACAAATTGTATGGGTCTCGTCTTCTCATTCATATTACGCGTCGTGTAGTCTATCCTTG
CCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGCAAAATTGGTGAACCTGCCATTGTGAGTTACTTTACGG
CCCGCACAAGCCTCGGAATTCTATTCTGAGCTTTCCCTACTAGAGGGCATTCATAGCAAGAGGTATTTCCAAGCG
CGTGAGTGTGGATTGTATCTCGCTTAAGCTCGTGATTTATCGTATGCGTGCTGTTTAGCATGATGCCGCTTCACG
GTATGATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCC
ACCTGCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCG
GCCTCCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAA
ACAGCGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail