Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044370
Gene name
Locationscaffold_2:1450057..1450940
Strand+
Gene length (bp)883
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09424 YqeY Yqey-like protein 1.6E-24 38 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7TN35|AIM41_VANPO Altered inheritance of mitochondria protein 41, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM41 PE=3 SV=1 42 190 1.0E-11
sp|Q6CRS3|AIM41_KLULA Altered inheritance of mitochondria protein 41, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM41 PE=3 SV=1 42 156 1.0E-08
sp|C4XYS2|AIM41_CLAL4 Altered inheritance of mitochondria protein 41, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM41 PE=3 SV=1 42 157 1.0E-08
sp|C5DXN2|AIM41_ZYGRC Altered inheritance of mitochondria protein 41, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM41 PE=3 SV=1 42 155 7.0E-08
sp|C6Y4B8|YA8O_SCHPO Uncharacterized protein C22F3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F3.15 PE=2 SV=1 15 129 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7TN35|AIM41_VANPO Altered inheritance of mitochondria protein 41, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=AIM41 PE=3 SV=1 42 190 1.0E-11
sp|Q6CRS3|AIM41_KLULA Altered inheritance of mitochondria protein 41, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM41 PE=3 SV=1 42 156 1.0E-08
sp|C4XYS2|AIM41_CLAL4 Altered inheritance of mitochondria protein 41, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM41 PE=3 SV=1 42 157 1.0E-08
sp|C5DXN2|AIM41_ZYGRC Altered inheritance of mitochondria protein 41, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM41 PE=3 SV=1 42 155 7.0E-08
sp|C6Y4B8|YA8O_SCHPO Uncharacterized protein C22F3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F3.15 PE=2 SV=1 15 129 2.0E-07
sp|C8ZGX0|AIM41_YEAS8 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM41 PE=3 SV=1 41 167 4.0E-07
sp|A6ZP58|AIM41_YEAS7 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM41 PE=3 SV=1 41 167 4.0E-07
sp|Q12032|AIM41_YEAST Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM41 PE=1 SV=1 42 167 1.0E-06
sp|B5VS96|AIM41_YEAS6 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|C7GWG7|AIM41_YEAS2 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|B3LJN9|AIM41_YEAS1 Altered inheritance of mitochondria protein 41, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM41 PE=3 SV=1 42 167 1.0E-06
sp|A5DKQ3|AIM41_PICGU Altered inheritance of mitochondria protein 41, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM41 PE=3 SV=2 42 172 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044370
MLPTCRAFRFLNGSHVNFPKHSRAFSASLPVPQDLRVRIMNDIKLALKSKDSMTATTLRSILADIQAADKSHKDS
KIGEPAIRAFIARGISKRHDAASRYDQARRLDLASKERQEAEILQRMLPPALSDSRIDEILKQIIDSLPPSANRP
PLGQVFKAFYAQVDKSLVRPDVLKQRAQAALSISHTSTASTS*
Coding >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAATCCAAG
GATTCTATGACGGCGACTACGCTGCGGTCTATCCTTGCCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGC
AAAATTGGTGAACCTGCCATTAGGGCATTCATAGCAAGAGGTATTTCCAAGCGCCATGATGCCGCTTCACGGTAT
GATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCCACCT
GCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCGGCCT
CCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAAACAG
CGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG
Transcript >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAATCCAAG
GATTCTATGACGGCGACTACGCTGCGGTCTATCCTTGCCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGC
AAAATTGGTGAACCTGCCATTAGGGCATTCATAGCAAGAGGTATTTCCAAGCGCCATGATGCCGCTTCACGGTAT
GATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCCACCT
GCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCGGCCT
CCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAAACAG
CGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG
Gene >AgabiH97|044370
ATGCTCCCAACCTGCCGTGCCTTTCGTTTTTTGAATGGATCTCATGTCAATTTCCCCAAACATTCTCGTGCTTTC
TCAGCGTCTCTTCCTGTTCCACAAGGTAAGAAGAATCATCCTACATGCAGCAACCGCGTTTGGCTCAACTTAAAC
CCAAATTTCCAATTCAGACCTGCGCGTTCGAATAATGAATGACATCAAGTTAGCTTTGAAAGTAAGAAGCACGCG
GTGCTCGTAGTGGTTCATATTCACGAACGTGCTAATGATTGTGGCAGTCCAAGGATTCTATGACGGCGACTACGC
TGCGGGTGAGCAATAGAACAAATTGTATGGGTCTCGTCTTCTCATTCATATTACGCGTCGTGTAGTCTATCCTTG
CCGATATTCAAGCCGCAGACAAATCTCACAAGGATAGCAAAATTGGTGAACCTGCCATTGTGAGTTACTTTACGG
CCCGCACAAGCCTCGGAATTCTATTCTGAGCTTTCCCTACTAGAGGGCATTCATAGCAAGAGGTATTTCCAAGCG
CGTGAGTGTGGATTGTATCTCGCTTAAGCTCGTGATTTATCGTATGCGTGCTGTTTAGCATGATGCCGCTTCACG
GTATGATCAAGCCAGACGTCTCGATCTCGCGTCCAAAGAACGCCAGGAAGCAGAAATCCTTCAAAGAATGCTCCC
ACCTGCCTTGTCAGACTCTCGAATTGATGAAATTTTGAAGCAAATCATTGATTCACTCCCACCTTCCGCTAACCG
GCCTCCACTGGGACAAGTCTTCAAAGCATTTTATGCTCAAGTCGATAAGTCCCTTGTCCGGCCTGACGTACTAAA
ACAGCGAGCTCAAGCGGCTTTGTCAATTTCCCATACATCAACTGCTTCAACTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail