Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044290
Gene name
Locationscaffold_2:1431799..1434339
Strand-
Gene length (bp)2540
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-60 96 357
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.1E-30 96 337
PF00169 PH PH domain 4.5E-06 594 687

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 93 475 2.0E-86
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 93 475 7.0E-86
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 93 475 2.0E-85
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 93 378 6.0E-85
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 86 380 5.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 93 475 2.0E-86
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 93 475 7.0E-86
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 93 475 2.0E-85
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 93 378 6.0E-85
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 86 380 5.0E-80
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 71 375 3.0E-77
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 75 375 2.0E-76
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 94 375 1.0E-73
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 88 376 4.0E-67
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 91 374 4.0E-65
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 91 367 9.0E-65
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 94 374 2.0E-61
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 91 392 3.0E-61
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 45 376 5.0E-59
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 91 367 2.0E-58
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 72 377 3.0E-57
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 66 377 2.0E-55
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 93 405 5.0E-52
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 87 366 4.0E-51
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 62 397 4.0E-51
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 72 367 8.0E-51
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 63 366 8.0E-51
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 94 367 9.0E-51
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 72 367 2.0E-50
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 83 378 3.0E-50
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 95 388 4.0E-50
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 87 366 4.0E-50
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 94 372 5.0E-50
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 72 367 5.0E-50
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 93 367 5.0E-50
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 93 367 5.0E-50
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 93 367 5.0E-50
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 93 367 6.0E-50
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 72 367 6.0E-50
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 93 367 7.0E-50
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 93 367 8.0E-50
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 72 367 1.0E-49
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 72 367 1.0E-49
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 58 371 1.0E-49
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 72 367 1.0E-49
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 91 366 2.0E-49
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 72 367 2.0E-49
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 63 366 2.0E-49
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 91 366 3.0E-49
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 91 374 4.0E-49
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 93 397 4.0E-49
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 63 371 4.0E-49
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 95 388 5.0E-49
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 89 366 5.0E-49
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 63 366 6.0E-49
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 66 366 1.0E-48
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 37 371 1.0E-48
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 91 366 1.0E-48
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 86 366 2.0E-48
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 83 366 2.0E-48
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 63 371 2.0E-48
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 95 367 2.0E-48
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 79 366 3.0E-48
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 63 366 4.0E-48
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 63 366 4.0E-48
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 67 366 4.0E-48
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 95 371 5.0E-48
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 95 371 5.0E-48
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 83 366 5.0E-48
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 63 366 7.0E-48
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 63 366 9.0E-48
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 95 371 9.0E-48
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 63 366 9.0E-48
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 63 366 1.0E-47
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 80 366 1.0E-47
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 79 366 2.0E-47
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 84 367 2.0E-47
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 67 366 2.0E-47
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 94 375 3.0E-47
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 94 371 4.0E-47
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 67 366 4.0E-47
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 65 366 6.0E-47
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 95 366 9.0E-47
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 95 371 1.0E-46
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 91 340 1.0E-46
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 91 366 1.0E-46
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 64 366 2.0E-46
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 2 338 2.0E-46
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 95 371 3.0E-46
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 91 371 3.0E-46
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 81 366 4.0E-46
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 91 371 5.0E-46
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 91 371 5.0E-46
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 95 371 8.0E-46
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 90 367 9.0E-46
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 100 383 1.0E-45
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 95 383 2.0E-45
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 95 383 2.0E-45
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 95 383 2.0E-45
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 99 364 3.0E-45
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 95 383 3.0E-45
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 95 383 3.0E-45
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 93 367 3.0E-45
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 67 371 5.0E-45
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 81 371 5.0E-45
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 89 383 6.0E-45
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 67 371 9.0E-45
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 68 338 1.0E-44
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 67 371 1.0E-44
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 94 378 2.0E-44
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 94 366 2.0E-44
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 67 371 2.0E-44
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 93 367 3.0E-44
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 94 367 3.0E-44
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 94 367 3.0E-44
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 94 383 4.0E-44
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 67 371 5.0E-44
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 67 367 6.0E-44
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 64 371 6.0E-44
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 95 372 8.0E-44
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 93 366 8.0E-44
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 91 367 1.0E-43
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 64 371 1.0E-43
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 99 394 1.0E-43
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 93 366 2.0E-43
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 86 364 2.0E-43
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 99 394 2.0E-43
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 63 371 2.0E-43
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 99 394 3.0E-43
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 64 367 3.0E-43
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 93 366 3.0E-43
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 81 371 3.0E-43
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 91 371 3.0E-43
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 68 338 4.0E-43
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 93 374 8.0E-43
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 77 366 8.0E-43
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 91 395 1.0E-42
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 94 401 2.0E-42
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 94 401 2.0E-42
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 64 366 2.0E-42
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 94 401 2.0E-42
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 71 372 3.0E-42
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 95 366 3.0E-42
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 94 338 3.0E-42
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 64 371 3.0E-42
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 91 366 3.0E-42
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 86 385 3.0E-42
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 90 389 5.0E-42
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 52 342 5.0E-42
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 78 389 6.0E-42
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 67 385 7.0E-42
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 93 372 8.0E-42
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 64 371 9.0E-42
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 64 366 1.0E-41
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 94 401 1.0E-41
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 48 371 1.0E-41
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 93 371 2.0E-41
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 101 383 2.0E-41
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 64 371 2.0E-41
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 101 383 3.0E-41
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 79 395 3.0E-41
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 95 340 3.0E-41
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 85 399 3.0E-41
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 64 371 3.0E-41
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 91 366 3.0E-41
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 64 371 3.0E-41
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 64 371 3.0E-41
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 90 371 3.0E-41
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 93 349 3.0E-41
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 83 367 3.0E-41
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 95 340 4.0E-41
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 94 371 6.0E-41
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 84 363 7.0E-41
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 87 363 8.0E-41
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 82 337 8.0E-41
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 93 356 8.0E-41
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 94 366 9.0E-41
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 94 366 9.0E-41
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 93 371 1.0E-40
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 33 341 1.0E-40
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 94 372 1.0E-40
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 85 371 1.0E-40
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 64 371 2.0E-40
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 84 363 2.0E-40
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 85 363 2.0E-40
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 94 372 2.0E-40
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 94 366 2.0E-40
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 91 363 2.0E-40
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 93 383 2.0E-40
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 95 382 2.0E-40
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 81 367 2.0E-40
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 77 361 4.0E-40
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 57 363 4.0E-40
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 93 372 5.0E-40
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 93 341 5.0E-40
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 90 371 6.0E-40
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 93 366 6.0E-40
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 94 375 6.0E-40
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 93 372 7.0E-40
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 93 338 8.0E-40
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 93 372 9.0E-40
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 91 340 9.0E-40
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 94 378 9.0E-40
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 93 395 1.0E-39
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 93 366 1.0E-39
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 85 340 1.0E-39
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 93 395 1.0E-39
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 93 366 1.0E-39
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 90 366 1.0E-39
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 93 337 1.0E-39
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 93 395 1.0E-39
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 74 372 2.0E-39
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 91 366 2.0E-39
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 93 366 2.0E-39
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 86 371 2.0E-39
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 95 383 2.0E-39
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 83 372 3.0E-39
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 93 337 3.0E-39
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 84 363 3.0E-39
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 101 372 3.0E-39
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 89 340 3.0E-39
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 93 337 3.0E-39
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 94 399 4.0E-39
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 94 372 4.0E-39
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 94 399 4.0E-39
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 94 399 4.0E-39
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 93 342 4.0E-39
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 94 399 4.0E-39
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 95 340 4.0E-39
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 94 395 4.0E-39
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 90 340 4.0E-39
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 93 366 5.0E-39
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 93 342 5.0E-39
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 90 366 6.0E-39
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 93 342 6.0E-39
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 85 366 7.0E-39
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 93 342 1.0E-38
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 81 340 1.0E-38
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 94 366 1.0E-38
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 46 372 1.0E-38
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 82 372 1.0E-38
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 93 371 1.0E-38
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 93 342 1.0E-38
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 85 366 2.0E-38
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 94 372 2.0E-38
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 94 372 2.0E-38
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 93 338 2.0E-38
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 95 338 3.0E-38
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 94 434 4.0E-38
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 98 337 4.0E-38
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 94 366 4.0E-38
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 90 364 5.0E-38
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 99 402 5.0E-38
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 94 434 5.0E-38
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 91 366 6.0E-38
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 86 340 6.0E-38
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 91 383 6.0E-38
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 91 338 7.0E-38
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 94 338 7.0E-38
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 95 340 8.0E-38
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 94 371 1.0E-37
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 81 338 1.0E-37
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 91 338 1.0E-37
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 84 402 1.0E-37
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 91 338 1.0E-37
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 77 366 1.0E-37
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 94 372 1.0E-37
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 34 338 1.0E-37
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 101 360 1.0E-37
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 85 366 1.0E-37
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 95 340 2.0E-37
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 90 341 2.0E-37
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 98 360 2.0E-37
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 83 403 2.0E-37
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 91 338 2.0E-37
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 94 366 3.0E-37
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 101 337 3.0E-37
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 66 366 3.0E-37
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 94 395 3.0E-37
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 79 340 3.0E-37
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 94 395 3.0E-37
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 85 363 4.0E-37
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 79 371 4.0E-37
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 94 395 5.0E-37
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 85 363 6.0E-37
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 101 360 6.0E-37
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 85 358 7.0E-37
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 38 338 7.0E-37
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 101 358 8.0E-37
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 94 363 8.0E-37
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 91 338 9.0E-37
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 99 323 9.0E-37
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 84 386 1.0E-36
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 95 358 1.0E-36
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 65 337 1.0E-36
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 100 340 1.0E-36
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 80 358 1.0E-36
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 101 338 2.0E-36
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 79 338 2.0E-36
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 83 363 2.0E-36
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 60 376 2.0E-36
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 98 360 2.0E-36
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 90 401 2.0E-36
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 91 374 3.0E-36
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 91 341 3.0E-36
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 100 340 3.0E-36
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 90 337 3.0E-36
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 95 340 3.0E-36
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 100 340 3.0E-36
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 101 360 3.0E-36
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 91 341 3.0E-36
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 100 340 3.0E-36
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 95 341 4.0E-36
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 82 340 4.0E-36
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 93 363 5.0E-36
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 91 338 5.0E-36
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 74 337 6.0E-36
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 101 338 7.0E-36
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 95 340 7.0E-36
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 84 337 8.0E-36
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 76 372 8.0E-36
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 71 337 8.0E-36
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 101 341 8.0E-36
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 91 340 9.0E-36
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 95 341 1.0E-35
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 82 340 1.0E-35
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 84 337 1.0E-35
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 95 340 1.0E-35
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 84 337 1.0E-35
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 25 366 1.0E-35
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 94 375 1.0E-35
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 101 342 2.0E-35
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 95 340 2.0E-35
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 90 363 2.0E-35
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 94 363 3.0E-35
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 86 340 3.0E-35
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 94 363 3.0E-35
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 76 372 3.0E-35
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 95 338 4.0E-35
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 83 364 4.0E-35
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 86 363 5.0E-35
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 91 374 5.0E-35
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 86 363 5.0E-35
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 95 340 5.0E-35
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 95 338 7.0E-35
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 86 363 7.0E-35
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 91 374 7.0E-35
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 86 363 7.0E-35
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 91 370 7.0E-35
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 91 374 8.0E-35
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 86 372 8.0E-35
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 95 341 1.0E-34
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 95 340 1.0E-34
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 95 337 1.0E-34
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 91 374 1.0E-34
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 95 337 1.0E-34
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 95 337 1.0E-34
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 87 338 2.0E-34
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 86 340 2.0E-34
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 84 366 2.0E-34
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 95 340 2.0E-34
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 95 337 2.0E-34
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 95 340 2.0E-34
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 95 340 2.0E-34
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 93 366 2.0E-34
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 93 338 2.0E-34
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 95 422 3.0E-34
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 93 362 3.0E-34
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 94 372 3.0E-34
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 95 340 3.0E-34
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 86 340 3.0E-34
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 95 422 3.0E-34
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 91 374 3.0E-34
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 101 363 4.0E-34
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 91 374 4.0E-34
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 91 374 5.0E-34
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 95 390 5.0E-34
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 91 340 6.0E-34
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 76 363 6.0E-34
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 100 371 7.0E-34
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 100 363 7.0E-34
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 86 363 7.0E-34
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 95 358 8.0E-34
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 35 338 8.0E-34
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 95 340 8.0E-34
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 86 363 9.0E-34
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 95 338 1.0E-33
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 86 363 1.0E-33
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 100 363 1.0E-33
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 95 340 1.0E-33
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 91 266 1.0E-33
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 93 340 1.0E-33
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens GN=PKN1 PE=1 SV=2 86 372 1.0E-33
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 65 337 1.0E-33
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 65 337 1.0E-33
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 93 340 1.0E-33
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 95 338 1.0E-33
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 90 388 2.0E-33
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 62 366 2.0E-33
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 93 366 2.0E-33
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 95 338 2.0E-33
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 87 340 2.0E-33
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 93 366 2.0E-33
sp|A1A4I4|PKN1_BOVIN Serine/threonine-protein kinase N1 OS=Bos taurus GN=PKN1 PE=2 SV=1 86 372 2.0E-33
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 79 337 2.0E-33
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 79 337 2.0E-33
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 87 338 3.0E-33
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 93 366 3.0E-33
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 93 366 3.0E-33
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 29 366 3.0E-33
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 86 372 3.0E-33
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 87 338 3.0E-33
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 91 373 3.0E-33
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 91 340 3.0E-33
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 91 252 3.0E-33
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 93 338 4.0E-33
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 93 366 4.0E-33
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 79 337 4.0E-33
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 93 359 4.0E-33
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 93 361 4.0E-33
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 95 376 4.0E-33
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 91 372 4.0E-33
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 81 340 4.0E-33
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 71 340 4.0E-33
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 91 374 5.0E-33
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 93 366 5.0E-33
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 93 366 5.0E-33
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 101 371 5.0E-33
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 87 338 5.0E-33
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 90 388 6.0E-33
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 87 338 6.0E-33
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 87 338 6.0E-33
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 90 388 6.0E-33
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 87 338 6.0E-33
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 91 338 6.0E-33
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 76 366 7.0E-33
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 91 340 7.0E-33
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 93 353 7.0E-33
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 93 337 7.0E-33
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 76 363 8.0E-33
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 90 388 9.0E-33
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 95 340 1.0E-32
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 95 340 1.0E-32
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 87 338 1.0E-32
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 95 340 1.0E-32
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 86 372 1.0E-32
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 92 337 1.0E-32
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 91 374 1.0E-32
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 95 340 1.0E-32
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 95 340 2.0E-32
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 91 338 2.0E-32
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 95 340 2.0E-32
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 101 371 2.0E-32
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 92 338 2.0E-32
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 100 393 2.0E-32
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 91 245 2.0E-32
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 91 360 2.0E-32
sp|P43250|GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2 90 393 2.0E-32
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 95 338 2.0E-32
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 91 338 2.0E-32
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 100 459 3.0E-32
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 94 340 3.0E-32
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 100 401 3.0E-32
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 93 366 3.0E-32
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 91 338 3.0E-32
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 84 366 3.0E-32
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 101 373 4.0E-32
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 94 340 4.0E-32
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 100 337 4.0E-32
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 95 337 5.0E-32
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 98 359 5.0E-32
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 81 341 5.0E-32
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 95 337 5.0E-32
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 93 366 5.0E-32
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 51 338 5.0E-32
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 93 340 5.0E-32
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 100 337 6.0E-32
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 95 340 6.0E-32
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 95 340 6.0E-32
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 87 339 7.0E-32
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 95 337 7.0E-32
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 91 338 7.0E-32
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 94 340 8.0E-32
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 95 338 8.0E-32
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 100 371 8.0E-32
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 95 370 9.0E-32
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 69 338 9.0E-32
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 69 338 1.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 95 338 1.0E-31
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 95 338 1.0E-31
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 95 340 1.0E-31
sp|O70293|GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus GN=Grk6 PE=1 SV=1 90 393 1.0E-31
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 76 411 1.0E-31
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 91 338 1.0E-31
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 92 340 1.0E-31
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 93 366 1.0E-31
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 87 338 1.0E-31
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 93 361 1.0E-31
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 76 460 2.0E-31
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 45 338 2.0E-31
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 94 338 2.0E-31
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 76 366 2.0E-31
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 66 359 2.0E-31
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 95 337 2.0E-31
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 92 338 2.0E-31
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 93 340 3.0E-31
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 98 359 3.0E-31
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 95 340 3.0E-31
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 89 338 2.0E-29
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 89 338 3.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 89 338 4.0E-29
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 92 338 1.0E-28
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 25 338 1.0E-28
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 25 338 1.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 46 338 1.0E-28
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 25 338 3.0E-28
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 101 340 1.0E-27
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 92 295 2.0E-26
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 251 366 4.0E-26
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 93 338 1.0E-25
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 100 338 1.0E-25
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 101 337 3.0E-25
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 87 337 5.0E-25
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 100 338 7.0E-25
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 251 374 5.0E-24
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 92 337 4.0E-23
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 171 338 1.0E-22
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 92 338 7.0E-22
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 93 300 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0097159 organic cyclic compound binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:0016310 phosphorylation No
GO:0000166 nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044290
MTSLSLADLSRNASAVSTDDSDDAPPLVPPRPRPARNFSAPRSISPHSAAPPRTHRIPTYLAADLGPSTDAAKQP
YLRARSKSRGRTAMTSTDDFKFGATLGEGSYSTVQKVTHIMTGQLYALKILEKSHLIRNNKMYVAIAERNALAAL
GGGHPGIVRLHSTFQDECRLYFVLDLARNGEMKSLLTKLGSLSLPCTRYYAAQLVDTIEYMHSKGVIHRDLKPEN
LLLDENNRMKICDFGTGKILETGVDRAQTWVGTAQYIAPELLEAKETSKSSDFWALGCIIYQFIAGRFAFQGLSD
FLTWQKIKKLEYSFPEGFDDEAKDLIQKLLVREPAERLGVGSPGSENDIQALKDHHFFTSINWEKIWVCPPPPLE
AGLFKKEDPLPPDNDHIWEDVEAAWDDIMAEDEMAWASDAEDHTYVIEANGYIPQVTTAKENELISPIDVPSGIE
GRRGTSSTIEGVEEIKRQLLEEQTGKKTPLTVEDSSATATTSSEGSRNIIATTVTPPIHTSASGSLPIQTSTQVT
SQTSSPPENERGRNPALSPKQGHAPLEAIEFAKHLKLPAEESVVFCSLVEERSMKRRASKLIPLVSHSRAKTRHL
VLTSNRLLCVKQRQKPQELSLKFELSLKASEKIKDKDKEKQSRGIIHSVQRKGDREFVVLTSTKVYNFAAPTSDL
VQRWLDSLQEALLLHGRKTSRPRT*
Coding >AgabiH97|044290
ATGACTTCGCTGTCCCTCGCCGATCTCAGCAGAAATGCGTCTGCCGTCTCCACCGACGACTCCGACGACGCCCCT
CCGCTCGTCCCTCCCCGCCCCCGCCCCGCCCGCAACTTCTCCGCCCCCCGCTCCATCTCTCCCCACTCCGCCGCC
CCGCCTCGCACACACCGCATACCCACCTACCTCGCTGCGGACCTCGGCCCCTCCACAGATGCTGCCAAACAGCCT
TATCTCCGTGCCCGCTCCAAGTCCCGCGGACGCACCGCCATGACCTCTACCGACGACTTCAAGTTTGGTGCAACC
CTTGGGGAAGGCTCATATTCCACGGTCCAGAAGGTTACTCATATCATGACTGGCCAACTATATGCTCTCAAAATT
CTCGAAAAATCTCATCTCATTCGGAATAACAAGATGTATGTAGCCATTGCGGAACGTAATGCCCTTGCTGCCCTC
GGCGGTGGCCATCCGGGTATCGTCCGCTTGCACTCGACTTTTCAGGATGAGTGCAGACTCTATTTTGTGCTCGAC
CTGGCCAGAAATGGTGAGATGAAGTCCCTTCTCACCAAGCTAGGCTCCCTCTCTCTCCCATGTACTCGTTACTAC
GCTGCCCAGCTCGTGGATACCATTGAATATATGCACTCTAAAGGAGTTATCCATCGGGATCTCAAGCCCGAAAAC
TTATTGCTCGATGAAAACAACCGCATGAAGATCTGTGATTTTGGCACAGGCAAGATTTTGGAAACAGGAGTCGAC
AGAGCCCAAACGTGGGTAGGAACAGCCCAATACATCGCCCCGGAGCTCCTGGAAGCCAAGGAAACAAGCAAAAGT
TCAGATTTCTGGGCCTTGGGATGCATCATATATCAATTTATTGCAGGCCGCTTTGCTTTTCAAGGGCTTTCTGAT
TTTTTGACCTGGCAAAAAATAAAGAAGCTCGAGTATAGTTTTCCTGAGGGTTTTGATGACGAGGCGAAAGATCTC
ATTCAGAAGCTCCTTGTACGCGAACCGGCAGAACGCCTTGGGGTTGGAAGTCCGGGGAGTGAAAATGATATACAG
GCGTTGAAGGATCACCATTTTTTCACGTCTATCAATTGGGAAAAGATTTGGGTGTGCCCCCCACCTCCACTTGAG
GCTGGCTTATTCAAGAAGGAGGATCCTCTTCCTCCAGATAACGACCATATCTGGGAAGATGTTGAAGCTGCTTGG
GATGATATAATGGCGGAAGACGAAATGGCTTGGGCATCCGATGCTGAAGACCATACATACGTGATTGAAGCCAAC
GGTTATATTCCGCAGGTTACTACTGCGAAGGAGAATGAGCTCATTAGCCCTATCGACGTACCTTCAGGCATTGAG
GGCCGGCGGGGAACAAGCTCTACCATTGAAGGCGTTGAAGAAATTAAACGCCAGTTGTTGGAGGAGCAAACGGGA
AAGAAAACCCCGCTCACAGTCGAAGACTCGTCTGCTACCGCGACAACTTCTTCTGAAGGCAGTCGCAACATAATT
GCTACTACCGTCACACCACCTATCCATACTTCTGCGTCAGGGTCATTACCTATCCAAACGTCCACTCAGGTGACA
TCGCAAACCTCAAGTCCTCCTGAGAATGAACGAGGGAGAAATCCCGCGTTGTCGCCCAAACAAGGGCATGCACCC
CTCGAGGCCATCGAATTCGCCAAACACTTGAAATTACCCGCCGAAGAATCTGTGGTCTTCTGTTCGCTCGTAGAG
GAGCGTTCAATGAAACGTCGAGCGAGTAAACTTATTCCCCTTGTCTCACATAGCAGAGCCAAGACACGTCATCTG
GTCCTCACGAGCAACCGTCTACTGTGTGTCAAGCAACGGCAAAAGCCACAGGAATTATCTCTCAAGTTTGAACTG
TCGCTTAAAGCTTCGGAGAAAATCAAGGATAAGGATAAAGAGAAACAGTCTAGAGGAATTATCCATTCGGTGCAA
AGAAAAGGGGACCGAGAGTTCGTCGTGCTAACGTCAACTAAAGTGTACAACTTTGCTGCACCTACCTCCGATCTT
GTCCAACGCTGGCTCGACAGTCTTCAAGAGGCTCTGTTATTGCATGGGCGCAAAACTTCTCGACCACGGACTTGA
Transcript >AgabiH97|044290
ATGACTTCGCTGTCCCTCGCCGATCTCAGCAGAAATGCGTCTGCCGTCTCCACCGACGACTCCGACGACGCCCCT
CCGCTCGTCCCTCCCCGCCCCCGCCCCGCCCGCAACTTCTCCGCCCCCCGCTCCATCTCTCCCCACTCCGCCGCC
CCGCCTCGCACACACCGCATACCCACCTACCTCGCTGCGGACCTCGGCCCCTCCACAGATGCTGCCAAACAGCCT
TATCTCCGTGCCCGCTCCAAGTCCCGCGGACGCACCGCCATGACCTCTACCGACGACTTCAAGTTTGGTGCAACC
CTTGGGGAAGGCTCATATTCCACGGTCCAGAAGGTTACTCATATCATGACTGGCCAACTATATGCTCTCAAAATT
CTCGAAAAATCTCATCTCATTCGGAATAACAAGATGTATGTAGCCATTGCGGAACGTAATGCCCTTGCTGCCCTC
GGCGGTGGCCATCCGGGTATCGTCCGCTTGCACTCGACTTTTCAGGATGAGTGCAGACTCTATTTTGTGCTCGAC
CTGGCCAGAAATGGTGAGATGAAGTCCCTTCTCACCAAGCTAGGCTCCCTCTCTCTCCCATGTACTCGTTACTAC
GCTGCCCAGCTCGTGGATACCATTGAATATATGCACTCTAAAGGAGTTATCCATCGGGATCTCAAGCCCGAAAAC
TTATTGCTCGATGAAAACAACCGCATGAAGATCTGTGATTTTGGCACAGGCAAGATTTTGGAAACAGGAGTCGAC
AGAGCCCAAACGTGGGTAGGAACAGCCCAATACATCGCCCCGGAGCTCCTGGAAGCCAAGGAAACAAGCAAAAGT
TCAGATTTCTGGGCCTTGGGATGCATCATATATCAATTTATTGCAGGCCGCTTTGCTTTTCAAGGGCTTTCTGAT
TTTTTGACCTGGCAAAAAATAAAGAAGCTCGAGTATAGTTTTCCTGAGGGTTTTGATGACGAGGCGAAAGATCTC
ATTCAGAAGCTCCTTGTACGCGAACCGGCAGAACGCCTTGGGGTTGGAAGTCCGGGGAGTGAAAATGATATACAG
GCGTTGAAGGATCACCATTTTTTCACGTCTATCAATTGGGAAAAGATTTGGGTGTGCCCCCCACCTCCACTTGAG
GCTGGCTTATTCAAGAAGGAGGATCCTCTTCCTCCAGATAACGACCATATCTGGGAAGATGTTGAAGCTGCTTGG
GATGATATAATGGCGGAAGACGAAATGGCTTGGGCATCCGATGCTGAAGACCATACATACGTGATTGAAGCCAAC
GGTTATATTCCGCAGGTTACTACTGCGAAGGAGAATGAGCTCATTAGCCCTATCGACGTACCTTCAGGCATTGAG
GGCCGGCGGGGAACAAGCTCTACCATTGAAGGCGTTGAAGAAATTAAACGCCAGTTGTTGGAGGAGCAAACGGGA
AAGAAAACCCCGCTCACAGTCGAAGACTCGTCTGCTACCGCGACAACTTCTTCTGAAGGCAGTCGCAACATAATT
GCTACTACCGTCACACCACCTATCCATACTTCTGCGTCAGGGTCATTACCTATCCAAACGTCCACTCAGGTGACA
TCGCAAACCTCAAGTCCTCCTGAGAATGAACGAGGGAGAAATCCCGCGTTGTCGCCCAAACAAGGGCATGCACCC
CTCGAGGCCATCGAATTCGCCAAACACTTGAAATTACCCGCCGAAGAATCTGTGGTCTTCTGTTCGCTCGTAGAG
GAGCGTTCAATGAAACGTCGAGCGAGTAAACTTATTCCCCTTGTCTCACATAGCAGAGCCAAGACACGTCATCTG
GTCCTCACGAGCAACCGTCTACTGTGTGTCAAGCAACGGCAAAAGCCACAGGAATTATCTCTCAAGTTTGAACTG
TCGCTTAAAGCTTCGGAGAAAATCAAGGATAAGGATAAAGAGAAACAGTCTAGAGGAATTATCCATTCGGTGCAA
AGAAAAGGGGACCGAGAGTTCGTCGTGCTAACGTCAACTAAAGTGTACAACTTTGCTGCACCTACCTCCGATCTT
GTCCAACGCTGGCTCGACAGTCTTCAAGAGGCTCTGTTATTGCATGGGCGCAAAACTTCTCGACCACGGACTTGA
Gene >AgabiH97|044290
ATGACTTCGCTGTCCCTCGCCGATCTCAGCAGAAATGCGTCTGCCGTCTCCACCGACGACTCCGACGACGCCCCT
CCGCTCGTCCCTCCCCGCCCCCGCCCCGCCCGCAACTTCTCCGCCCCCCGCTCCATCTCTCCCCACTCCGCCGCC
CCGCCTCGCACACACCGCATACCCACCTACCTCGCTGCGGACCTCGGCCCCTCCACAGATGCTGCCAAACAGCCT
TATCTCCGTGCCCGCTCCAAGTCCCGCGGACGCACCGCCATGACCTCTACCGACGACTTCAAGTTTGGTGCAACC
CTTGGGGAAGGCTCATATTCCACGGCAAGTCACCCCTTCCCCCAGTGCGACAAGAAACGCGTCTCATATGCTCCT
CTCGCAGGTCCAGAAGGTTACTCATATCATGACTGGCCAACTATATGCTCTCAAAATTCTCGAAAAATCTCATCT
CATTCGGAATAACAAGATGTATGTAGCCATTGCGGAACGTAATGCCCTTGCTGCCCTCGGCGGTGGCCATCCGGG
TATCGTCCGCTTGCACTCGACTTTTCAGGATGAGTGCAGACTCTGTGCGTGCACCAATTCCTGCTTTCTCTCTAC
GCAGCCGCCTCTAACCTGTTTAGATTTTGTGCTCGACCTGGCCAGAAATGGTGAGATGAAGTCCCTTCTCACCAA
GCTAGGCTCCCTCTCTCTCCCATGTACTCGTTACTACGCTGCCCAGCTCGTGGATACCATTGAATATATGCACTC
TAAAGGAGTTATCCATCGGTACTCTCTCTCTCTTCCCTTCACCGTTCTTCCATGATCATTCTCAACACTTAATCA
GGGATCTCAAGCCCGAAAACTTATTGCTCGATGAAAACAACCGCATGAAGATCTGTGATTTTGGCACAGGCAAGA
TTTTGGAAACAGGAGGTCAGCTTACGTATTCACCTATTCCCATTGCGCAGCTCTCAATTCGAATTGGCAGTCGAC
AGAGCCCAAACGTGGGTAGGAACAGCCCAATACATCGCCCCGGAGCTCCTGGAAGCCAAGGAAACAAGCAAAAGG
TAGATTTGGCTCTTCAGTCTACGATACACTGATCTTAAAAAAGGATGCTAGTTCAGATTTCTGGGCCTTGGGATG
CATCATATATCAATTTATTGCAGGCCGCTTTGCTTTTCAAGGGCTTTCTGATTTTTTGACCTGGCAAAAAATAAA
GAAGCTCGAGTATAGTTTTCCTGAGGGTTTTGATGACGAGGCGAAAGATCTCATTCAGAAGCTCCTTGTGCGTGG
TCTCCTTTCCTACCACAACTTTCCCCTCCATGTTTACCTCCATCCATCAGGTACGCGAACCGGCAGAACGCCTTG
GGGTTGGAAGTCCGGGGAGTGAAAATGATATACAGGCGTTGAAGGATCACCATTTTTTCACGTCTATCAATTGGG
AAAAGATTTGGGTGTGCCCCCCACCTCCACTTGAGGCTGGCTTATTCAAGAAGGAGGATCCTCTTCCTCCAGATA
ACGACCATATCTGGGAAGATGTTGAAGCTGCTTGGGATGATATAATGGCGGAAGACGAAATGGCTTGGGCATCCG
ATGCTGAAGACCATACATACGTGATTGAAGCCAACGGTTATATTCCGCAGGTTACTACTGCGAAGGAGAATGAGC
TCATTAGCCCTATCGACGTACCTTCAGGCATTGAGGGCCGGCGGGGAACAAGCTCTACCATTGAAGGCGTTGAAG
AAATTAAACGCCAGTTGTTGGAGGAGCAAACGGGAAAGAAAACCCCGCTCACAGTCGAAGACTCGTCTGCTACCG
CGACAACTTCTTCTGAAGGCAGTCGCAACATAATTGCTACTACCGTCACACCACCTATCCATACTTCTGCGTCAG
GGTCATTACCTATCCAAACGTCCACTCAGGTGACATCGCAAACCTCAAGTCCTCCTGAGAATGAACGAGGGAGAA
ATCCCGCGTTGTCGCCCAAACAAGGGCATGCACCCCTCGAGGCCATCGAATTGTGAGCTCGAGAATTCTTCTTGT
CGCTCCCTTCTCCTCTTATATCTTGTCTTCAGCGCCAAACACTTGAAATTACCCGCCGAAGAATCTGTGGTCTTC
TGTTCGCTCGTAGAGGAGCGTTCAATGAAACGTCGAGCGAGTAAACTTATTCCCCTTGTCTCACATAGCAGAGCC
AAGACACGTCATCTGGTCCTCACGAGCAACCGTCTACTGTGTGTCAAGCAACGGCAAAAGCCACAGGAATTATCT
CTCAAGTTTGAACTGTCGCTTAAAGCTTCGGAGAAAATCAAGGATAAGGATAAAGAGAAACAGTCTAGAGGAATT
ATCCATTCGGTGCAAAGAAAAGGGGACCGAGAGTTCGTCGTGCTAACGGTGAGCACTTGCATGGTCACTCATACC
TCCGTTTCTCAACAACGGTCCAGTCAACTAAAGTGTACAACTTTGCTGCACCTACCTCCGATCTTGTCCAACGCT
GGCTCGACAGTCTTCAAGAGGCTCTGTTATTGCATGGGCGCAAAACTTCTCGACCACGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail