Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044160
Gene name
Locationscaffold_2:1410234..1411403
Strand-
Gene length (bp)1169
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02089 Palm_thioest Palmitoyl protein thioesterase 3.8E-91 25 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 25 298 3.0E-56
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 21 302 3.0E-56
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 21 302 4.0E-56
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 21 302 3.0E-55
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 21 302 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 25 298 3.0E-56
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 21 302 3.0E-56
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 21 302 4.0E-56
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 21 302 3.0E-55
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 21 302 3.0E-54
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 21 302 3.0E-53
sp|Q9W3C7|PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster GN=Ppt1 PE=1 SV=2 17 302 6.0E-47
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 12 309 4.0E-41
sp|Q54CM0|PPT3_DICDI Palmitoyl-protein thioesterase 3 OS=Dictyostelium discoideum GN=ppt3 PE=3 SV=1 20 297 7.0E-33
sp|O70489|PPT2_RAT Lysosomal thioesterase PPT2 OS=Rattus norvegicus GN=Ppt2 PE=2 SV=1 22 293 2.0E-21
sp|O35448|PPT2_MOUSE Lysosomal thioesterase PPT2 OS=Mus musculus GN=Ppt2 PE=1 SV=1 22 293 2.0E-21
sp|Q9UMR5|PPT2_HUMAN Lysosomal thioesterase PPT2 OS=Homo sapiens GN=PPT2 PE=1 SV=4 22 293 1.0E-20
sp|Q1JQA0|PPT2_BOVIN Lysosomal thioesterase PPT2 OS=Bos taurus GN=PPT2 PE=2 SV=1 24 293 9.0E-20
sp|Q9VKH6|PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster GN=Ppt2 PE=2 SV=1 24 287 1.0E-19
sp|Q6GNY7|PPT2B_XENLA Lysosomal thioesterase PPT2-B OS=Xenopus laevis GN=ppt2-b PE=2 SV=1 22 293 2.0E-19
sp|Q6PCJ9|PPT2A_XENLA Lysosomal thioesterase PPT2-A OS=Xenopus laevis GN=ppt2-a PE=2 SV=1 24 287 5.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 78.38 44.91 111.86
Initials Initials knots 52.55 30.22 74.89
Pileal_Stipeal_center Stage I stipe center 114.86 69.07 160.64
Pileal_Stipeal_shell Stage I stipe shell 135.34 81.22 189.47
DIF_stipe_center Stage II stipe center 104.47 62.60 146.34
DIF_stipe_shell Stage II stipe shell 85.41 50.89 119.93
DIF_stipe_skin Stage II stipe skin 98.53 58.74 138.32
DIF_cap_skin Stage II cap skin 131.22 78.70 183.74
DIF_cap_tissue Stage II cap tissue 120.47 72.43 168.52
DIF_gill_tissue Stage II gill tissue 128.50 77.32 179.68
YFB_stipe_center Young fruiting body stipe center 87.12 50.83 123.41
YFB_stipe_shell Young fruiting body stipe shell 69.53 40.60 98.46
YFB_stipe_skin Young fruiting body stipe skin 96.87 57.40 136.35
YFB_cap_skin Young fruiting body cap skin 142.31 85.51 199.11
YFB_cap_tissue Young fruiting body cap tissue 117.19 70.45 163.93
YFB_gill_tissue Young fruiting body gill tissue 145.97 87.63 204.31
YFB_veil Young fruiting body veil 137.73 82.77 192.69

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.074661 no
Casing YFB_stipe_center 0.826218 no
Casing YFB_stipe_shell 0.798913 no
Casing YFB_stipe_skin 0.579797 no
Casing YFB_cap_skin 0.026955 yes
Casing YFB_cap_tissue 0.173347 no
Casing YFB_gill_tissue 0.019715 yes
Casing YFB_veil 0.036911 yes
Casing Initials 0.198914 no
Casing Pileal_Stipeal_center 0.209256 no
Casing Pileal_Stipeal_shell 0.047373 yes
Casing DIF_stipe_center 0.395957 no
Casing DIF_stipe_shell 0.864259 no
Casing DIF_stipe_skin 0.536081 no
Casing DIF_cap_skin 0.061086 no
Casing DIF_cap_tissue 0.134719 no
DIF_gill_tissue YFB_stipe_center 0.178830 no
DIF_gill_tissue YFB_stipe_shell 0.018896 yes
DIF_gill_tissue YFB_stipe_skin 0.389945 no
DIF_gill_tissue YFB_cap_skin 0.818786 no
DIF_gill_tissue YFB_cap_tissue 0.843341 no
DIF_gill_tissue YFB_gill_tissue 0.764295 no
DIF_gill_tissue YFB_veil 0.887638 no
YFB_stipe_center YFB_stipe_shell 0.545316 no
YFB_stipe_center YFB_stipe_skin 0.820582 no
YFB_stipe_center YFB_cap_skin 0.075908 no
YFB_stipe_center YFB_cap_tissue 0.358230 no
YFB_stipe_center YFB_gill_tissue 0.056367 no
YFB_stipe_center YFB_veil 0.099595 no
YFB_stipe_shell YFB_stipe_skin 0.296112 no
YFB_stipe_shell YFB_cap_skin 0.006387 yes
YFB_stipe_shell YFB_cap_tissue 0.056367 no
YFB_stipe_shell YFB_gill_tissue 0.004548 yes
YFB_stipe_shell YFB_veil 0.007782 yes
YFB_stipe_skin YFB_cap_skin 0.189762 no
YFB_stipe_skin YFB_cap_tissue 0.613438 no
YFB_stipe_skin YFB_gill_tissue 0.151656 no
YFB_stipe_skin YFB_veil 0.243731 no
YFB_cap_skin YFB_cap_tissue 0.598176 no
YFB_cap_skin YFB_gill_tissue 0.963335 no
YFB_cap_skin YFB_veil 0.953385 no
YFB_cap_tissue YFB_gill_tissue 0.528753 no
YFB_cap_tissue YFB_veil 0.682837 no
YFB_gill_tissue YFB_veil 0.909219 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.074130 no
Initials YFB_stipe_shell 0.423692 no
Initials YFB_stipe_skin 0.026955 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.001140 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.003365 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.009446 yes
Initials DIF_stipe_shell 0.090151 no
Initials DIF_stipe_skin 0.021056 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.801376 no
Pileal_Stipeal_center YFB_stipe_center 0.407453 no
Pileal_Stipeal_center YFB_stipe_shell 0.070681 no
Pileal_Stipeal_center YFB_stipe_skin 0.669500 no
Pileal_Stipeal_center YFB_cap_skin 0.543543 no
Pileal_Stipeal_center YFB_cap_tissue 0.970338 no
Pileal_Stipeal_center YFB_gill_tissue 0.483189 no
Pileal_Stipeal_center YFB_veil 0.634752 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.678648 no
Pileal_Stipeal_center DIF_stipe_center 0.839133 no
Pileal_Stipeal_center DIF_stipe_shell 0.364099 no
Pileal_Stipeal_center DIF_stipe_skin 0.709908 no
Pileal_Stipeal_center DIF_cap_skin 0.752354 no
Pileal_Stipeal_center DIF_cap_tissue 0.925128 no
Pileal_Stipeal_shell DIF_gill_tissue 0.918132 no
Pileal_Stipeal_shell YFB_stipe_center 0.114271 no
Pileal_Stipeal_shell YFB_stipe_shell 0.009123 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.272730 no
Pileal_Stipeal_shell YFB_cap_skin 0.919747 no
Pileal_Stipeal_shell YFB_cap_tissue 0.719318 no
Pileal_Stipeal_shell YFB_gill_tissue 0.873595 no
Pileal_Stipeal_shell YFB_veil 0.973755 no
Pileal_Stipeal_shell DIF_stipe_center 0.431613 no
Pileal_Stipeal_shell DIF_stipe_shell 0.095478 no
Pileal_Stipeal_shell DIF_stipe_skin 0.303820 no
Pileal_Stipeal_shell DIF_cap_skin 0.953149 no
Pileal_Stipeal_shell DIF_cap_tissue 0.786022 no
DIF_stipe_center DIF_gill_tissue 0.563359 no
DIF_stipe_center YFB_stipe_center 0.637149 no
DIF_stipe_center YFB_stipe_shell 0.158228 no
DIF_stipe_center YFB_stipe_skin 0.876519 no
DIF_stipe_center YFB_cap_skin 0.314071 no
DIF_stipe_center YFB_cap_tissue 0.791067 no
DIF_stipe_center YFB_gill_tissue 0.263495 no
DIF_stipe_center YFB_veil 0.390800 no
DIF_stipe_center DIF_stipe_shell 0.584067 no
DIF_stipe_center DIF_stipe_skin 0.908752 no
DIF_stipe_center DIF_cap_skin 0.506011 no
DIF_stipe_center DIF_cap_tissue 0.724325 no
DIF_stipe_shell DIF_gill_tissue 0.150982 no
DIF_stipe_shell YFB_stipe_center 0.972063 no
DIF_stipe_shell YFB_stipe_shell 0.587937 no
DIF_stipe_shell YFB_stipe_skin 0.776570 no
DIF_stipe_shell YFB_cap_skin 0.062610 no
DIF_stipe_shell YFB_cap_tissue 0.309546 no
DIF_stipe_shell YFB_gill_tissue 0.044418 yes
DIF_stipe_shell YFB_veil 0.078944 no
DIF_stipe_shell DIF_stipe_skin 0.738696 no
DIF_stipe_shell DIF_cap_skin 0.130962 no
DIF_stipe_shell DIF_cap_tissue 0.253793 no
DIF_stipe_skin DIF_gill_tissue 0.430826 no
DIF_stipe_skin YFB_stipe_center 0.786231 no
DIF_stipe_skin YFB_stipe_shell 0.265944 no
DIF_stipe_skin YFB_stipe_skin 0.975724 no
DIF_stipe_skin YFB_cap_skin 0.220561 no
DIF_stipe_skin YFB_cap_tissue 0.660009 no
DIF_stipe_skin YFB_gill_tissue 0.178069 no
DIF_stipe_skin YFB_veil 0.275250 no
DIF_stipe_skin DIF_cap_skin 0.377104 no
DIF_stipe_skin DIF_cap_tissue 0.589729 no
DIF_cap_skin DIF_gill_tissue 0.969852 no
DIF_cap_skin YFB_stipe_center 0.150574 no
DIF_cap_skin YFB_stipe_shell 0.013186 yes
DIF_cap_skin YFB_stipe_skin 0.342385 no
DIF_cap_skin YFB_cap_skin 0.864100 no
DIF_cap_skin YFB_cap_tissue 0.797807 no
DIF_cap_skin YFB_gill_tissue 0.810780 no
DIF_cap_skin YFB_veil 0.926903 no
DIF_cap_skin DIF_cap_tissue 0.855080 no
DIF_cap_tissue DIF_gill_tissue 0.894972 no
DIF_cap_tissue YFB_stipe_center 0.293279 no
DIF_cap_tissue YFB_stipe_shell 0.040947 yes
DIF_cap_tissue YFB_stipe_skin 0.538578 no
DIF_cap_tissue YFB_cap_skin 0.660130 no
DIF_cap_tissue YFB_cap_tissue 0.957628 no
DIF_cap_tissue YFB_gill_tissue 0.597762 no
DIF_cap_tissue YFB_veil 0.749213 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044160
MSLWFILLGFAVHLALASTIPSPRPLVLWHGLGDSHSSPGMLEFMNLIKEIHPGIFVHSIFISEDLNEDKKAGFY
GNVLEQLEFVADQLAAIPELEAGFDAVGLSQGGQFLRAYVECYNNPPVNNLITFGSQHMGISDIPICRPFDFLCQ
IARKAAKRAVYSTWAQENLIQAQYYRDPNNYASYLHANHFLPYVNNEIEEARNQTYARNFASLSNLVLVMFTEDK
LVVPKESSWFGYEELRDSVVSDASDQQRFLAMDKKIIPMREQPLYIEDWIGLRELDERGAVVFSECVGEHMEMGD
CWEELIVEYTGGSL*
Coding >AgabiH97|044160
ATGTCACTCTGGTTCATCCTCCTCGGTTTCGCTGTTCACCTTGCGTTGGCATCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAACCTCATCAAGGAG
ATACACCCCGGAATCTTCGTCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCTAC
GGAAACGTTCTTGAGCAGCTGGAATTTGTGGCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGAC
GCGGTGGGCCTCTCGCAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTTACAATAATCCACCCGTCAATAAC
CTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCAATATGCAGACCGTTCGATTTTCTATGTCAG
ATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGTACCTGGGCTCAAGAAAATCTGATTCAGGCCCAGTATTAT
CGTGATCCAAATAATTATGCATCATATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAA
GCGCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAACCTCGTGCTGGTCATGTTTACAGAAGACAAG
TTGGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTGAGAGACAGCGTTGTGTCCGACGCGTCGGAT
CAGCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATA
GGATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGAC
TGCTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG
Transcript >AgabiH97|044160
ATGTCACTCTGGTTCATCCTCCTCGGTTTCGCTGTTCACCTTGCGTTGGCATCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAACCTCATCAAGGAG
ATACACCCCGGAATCTTCGTCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCTAC
GGAAACGTTCTTGAGCAGCTGGAATTTGTGGCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGAC
GCGGTGGGCCTCTCGCAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTTACAATAATCCACCCGTCAATAAC
CTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCAATATGCAGACCGTTCGATTTTCTATGTCAG
ATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGTACCTGGGCTCAAGAAAATCTGATTCAGGCCCAGTATTAT
CGTGATCCAAATAATTATGCATCATATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAA
GCGCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAACCTCGTGCTGGTCATGTTTACAGAAGACAAG
TTGGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTGAGAGACAGCGTTGTGTCCGACGCGTCGGAT
CAGCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATA
GGATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGAC
TGCTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG
Gene >AgabiH97|044160
ATGTCACTCTGGTTCATCCTCCTCGGTTTCGCTGTTCACCTTGCGTTGGCATCTACCATCCCGTCTCCACGGCCA
CTTGTTCTCTGGCATGGTTTGGGTAGGAATGAGTCCTTGGGAATACAGAGTAGCATTTGCCCTTAGCTAATTTCC
TCGCGCAGGGGATTCGCATTCCTCACCCGGAATGCTTGAATTTATGAACCTCATCAAGGAGATACACCCCGGAAT
CTTCGTCCATTCCATATTTATTTCGGAAGACCTGAATGAAGACAAGAAAGCTGGTTTCGTATGACAGCCGCGTCT
TTCAAAGTTATTCTACTGATTATCGAGAAATGGGTGCATGTAGTACGGAAACGTTCTTGAGCAGCTGGAATTTGT
GGCAGATCAGCTCGCCGCCATACCAGAACTGGAAGCTGGATTCGACGCGGTGGGCCTCTCGCAAGGTTTGTCCAG
CTACTCTATGTGTACTGTTAAGCTAGTATTGAAACAAAGAAGGTGGTCAATTCTTGCGAGCATATGTCGAATGTT
ACAATAATCCACCCGTCAATAACCTCATCACGTTTGGCTCTCAACACATGGGTATCTCTGATATACCAATATGCA
GACCGTTCGATTTTCTATGTCAGATTGCTCGAAAGGCAGCCAAGAGAGCGGTTTATAGTACCTGGGCTCAAGAAA
ATCTGATTCAGGTGAGCGTTGGCGTTGGTGACCTGAAGATGATTAATTCTTATGTCCTATAGGCCCAGTATTATC
GTGATCCAAATAATTATGCATCATATCTCCACGCGAACCACTTCCTTCCATACGTCAACAATGAAATCGAGGAAG
CGCGCAATCAGACTTATGCACGCAACTTTGCTTCCCTGAGTAACCTCGTGCTGGTCATGTTTACAGAAGACAAGT
TGGTGGTGCCAAAAGAGAGCTCCTGGTTCGGATATGAAGAATTGAGAGACAGCGTTGTGTCCGACGCGTCGGATC
AGCAGCGCTTCTTAGCAATGGACAAGAAGATCATTCCGATGAGGGAACAACCGCTGTATATTGAAGATTGGATAG
GATTGCGGGAGCTGGATGAGCGCGGGGCGGTTGTTTTTTCCGAGTGCGTTGGCGAGCACATGGAGATGGGAGACT
GCTGGGAAGAGCTGATTGTCGAGTACACGGGAGGGAGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail