Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044060
Gene name
Locationscaffold_2:1384100..1386258
Strand+
Gene length (bp)2158
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-15 28 385

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 3 404 5.0E-60
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 3 404 5.0E-60
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 3 404 5.0E-58
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 21 403 2.0E-43
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 24 404 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 3 404 5.0E-60
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 3 404 5.0E-60
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 3 404 5.0E-58
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 21 403 2.0E-43
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 24 404 1.0E-42
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 16 402 1.0E-41
sp|Q9ZK41|GLUP_HELPJ Putative glucose/galactose transporter OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gluP PE=3 SV=1 24 404 3.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 57 76 19
3 86 103 17
4 110 132 22
5 152 171 19
6 184 203 19
7 239 261 22
8 274 296 22
9 300 322 22
10 329 348 19
11 358 380 22
12 389 408 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044060
MPPPKGTTGSELSTARWAFAFTLVTTLFFTWGFAYGLLDVLNAHFQDIFGISRTQSTLLQFAYFGAYLVFAPIAS
VFMDRYGYKSGIHLGLSLYSLGAIFFWPSAKFAKYGGFVGCTFVIGCGLATLEVAANSYIAVLGTPKYAAARLNF
SQGFQGLAAFAGPLIASKYFFRGENSTKLDTVQWVYLAVAGLGVLLNVMFYFCKLPEITGDALAAEIHEVGIRAD
EEPFWKQYRCIFGFVAQMAYVGAQVGVASLAVNYFSEQGLGIDRSRASFLYSFCQLTFMFGRFAGVAILHFIDPA
LLLSLYAVACSLFTILTGVLGGNGGVGSLFALFWFESICYPCIFTLGTKNLGIYTKRGSGLIVMGVGGGAWFPPA
QASLADKVSTRRSYLVPLAGYLAMTIYAIGMVVDQTIKESFRFRNIDELKERRAMMGGAPERETQDIDEKAKDTS
GSDEIEKA*
Coding >AgabiH97|044060
ATGCCTCCACCAAAGGGAACCACAGGCTCTGAGCTCTCGACTGCTCGATGGGCATTTGCCTTTACGTTGGTAACG
ACACTATTCTTTACATGGGGTTTTGCTTATGGGCTCCTTGACGTTCTCAATGCCCATTTCCAAGATATTTTCGGC
ATCAGTAGAACGCAGAGTACTCTACTGCAATTTGCCTACTTCGGTGCTTATCTAGTCTTCGCACCAATCGCAAGT
GTGTTCATGGATCGGTATGGGTACAAGAGCGGCATCCATCTAGGCCTTAGCCTATACAGCCTAGGTGCTATTTTC
TTCTGGCCATCGGCGAAGTTTGCGAAGTACGGCGGATTCGTGGGATGCACTTTTGTGATTGGATGTGGTCTGGCC
ACACTGGAAGTGGCTGCAAATTCTTATATCGCAGTTCTTGGTACACCCAAGTACGCTGCAGCGCGGTTGAATTTC
AGCCAGGGCTTTCAGGGTCTTGCAGCTTTTGCTGGCCCTTTGATTGCCTCTAAATATTTTTTTCGCGGGGAAAAC
TCCACGAAACTGGACACTGTGCAATGGGTTTATCTTGCAGTGGCAGGACTTGGAGTCCTTCTTAATGTCATGTTT
TACTTTTGCAAGTTGCCGGAAATCACGGGAGACGCTCTCGCCGCAGAAATTCATGAAGTTGGTATCCGCGCCGAC
GAGGAGCCGTTCTGGAAGCAATATAGGTGTATATTCGGGTTCGTTGCACAGATGGCTTATGTAGGAGCTCAAGTC
GGTGTCGCATCACTTGCGGTGAACTACTTCTCCGAGCAAGGTCTCGGGATCGATAGATCGAGGGCCAGCTTCCTA
TACTCTTTCTGTCAATTGACGTTCATGTTTGGAAGGTTTGCTGGTGTAGCCATCCTCCACTTTATCGATCCTGCA
CTGCTACTGTCTTTGTATGCGGTGGCATGTAGCTTATTTACGATACTTACTGGGGTGCTTGGGGGAAATGGAGGT
GTTGGCTCCTTATTCGCCCTATTTTGGTTCGAGTCTATCTGTTATCCGTGCATCTTTACTCTGGGTACGAAGAAC
TTGGGTATTTACACTAAACGGGGGTCGGGTCTGATTGTTATGGGTGTTGGTGGTGGTGCATGGTTCCCTCCGGCA
CAAGCCAGTCTCGCGGATAAGGTTTCTACCCGGCGTTCGTACTTGGTCCCACTTGCAGGCTATTTGGCTATGACA
ATCTACGCAATCGGCATGGTAGTAGATCAAACTATAAAGGAATCATTCAGGTTCCGCAATATTGACGAATTGAAG
GAGAGAAGGGCGATGATGGGTGGAGCACCAGAACGAGAGACTCAAGATATTGACGAAAAGGCAAAAGACACATCC
GGCAGCGATGAGATTGAAAAAGCTTGA
Transcript >AgabiH97|044060
ATGCCTCCACCAAAGGGAACCACAGGCTCTGAGCTCTCGACTGCTCGATGGGCATTTGCCTTTACGTTGGTAACG
ACACTATTCTTTACATGGGGTTTTGCTTATGGGCTCCTTGACGTTCTCAATGCCCATTTCCAAGATATTTTCGGC
ATCAGTAGAACGCAGAGTACTCTACTGCAATTTGCCTACTTCGGTGCTTATCTAGTCTTCGCACCAATCGCAAGT
GTGTTCATGGATCGGTATGGGTACAAGAGCGGCATCCATCTAGGCCTTAGCCTATACAGCCTAGGTGCTATTTTC
TTCTGGCCATCGGCGAAGTTTGCGAAGTACGGCGGATTCGTGGGATGCACTTTTGTGATTGGATGTGGTCTGGCC
ACACTGGAAGTGGCTGCAAATTCTTATATCGCAGTTCTTGGTACACCCAAGTACGCTGCAGCGCGGTTGAATTTC
AGCCAGGGCTTTCAGGGTCTTGCAGCTTTTGCTGGCCCTTTGATTGCCTCTAAATATTTTTTTCGCGGGGAAAAC
TCCACGAAACTGGACACTGTGCAATGGGTTTATCTTGCAGTGGCAGGACTTGGAGTCCTTCTTAATGTCATGTTT
TACTTTTGCAAGTTGCCGGAAATCACGGGAGACGCTCTCGCCGCAGAAATTCATGAAGTTGGTATCCGCGCCGAC
GAGGAGCCGTTCTGGAAGCAATATAGGTGTATATTCGGGTTCGTTGCACAGATGGCTTATGTAGGAGCTCAAGTC
GGTGTCGCATCACTTGCGGTGAACTACTTCTCCGAGCAAGGTCTCGGGATCGATAGATCGAGGGCCAGCTTCCTA
TACTCTTTCTGTCAATTGACGTTCATGTTTGGAAGGTTTGCTGGTGTAGCCATCCTCCACTTTATCGATCCTGCA
CTGCTACTGTCTTTGTATGCGGTGGCATGTAGCTTATTTACGATACTTACTGGGGTGCTTGGGGGAAATGGAGGT
GTTGGCTCCTTATTCGCCCTATTTTGGTTCGAGTCTATCTGTTATCCGTGCATCTTTACTCTGGGTACGAAGAAC
TTGGGTATTTACACTAAACGGGGGTCGGGTCTGATTGTTATGGGTGTTGGTGGTGGTGCATGGTTCCCTCCGGCA
CAAGCCAGTCTCGCGGATAAGGTTTCTACCCGGCGTTCGTACTTGGTCCCACTTGCAGGCTATTTGGCTATGACA
ATCTACGCAATCGGCATGGTAGTAGATCAAACTATAAAGGAATCATTCAGGTTCCGCAATATTGACGAATTGAAG
GAGAGAAGGGCGATGATGGGTGGAGCACCAGAACGAGAGACTCAAGATATTGACGAAAAGGCAAAAGACACATCC
GGCAGCGATGAGATTGAAAAAGCTTGA
Gene >AgabiH97|044060
ATGCCTCCACCAAAGGGAACCACAGGTGCGCTTTGGAGCAATATTATTCAAAGTACTCCGATCTAATCTAATCAC
GTCAGGCTCTGAGCTCTCGACTGCTCGATGGGCATTTGCCTTTACGTTGGTAACGACACTATTCTTTACATGTAA
GTCGATTAGCCTCGTTGCTCTTTGGATAGCAAATGACTAGGGTTACAGGGGGTTTTGCTTATGGGGTTAGTTAAT
CTGTTTATTGCGAAAAAGAGAACAGTCTCGCTGAGCCTAATATAGCTCCTTGACGTTCTCAATGCCCATTTCCAA
GATATTTTCGGCATCAGTAGAACGCAGAGTACTCTACTGCAATTTGCCTACTTCGGTGCTTATCTAGTCTTCGCA
CCAATCGCAAGTGTGTTCGTACGTCATTTTGCTACCGGCTTCACTCGTGGGTCAACTAATCCGGTGCTCGCAAAA
AAATAGATGGATCGGTATGGGTACAAGGTAATTAATAATAAACAGTACCAAGTGCATCTTGACTGGAAAACGTTT
CCTTTCTTTGACAGAGCGGCATCCATCTAGGCCTTAGCCTATACAGCCTAGGTGAGAATACCGGTCATCAACTTC
ACATAGTATAATCTATAAATCCTGCTAGGTGCTATTTTCTTCTGGCCATCGGCGAAGTTTGCGAAGTACGGCGGA
TTCGTGGGATGCACTTTTGTGATTGGTGAGTAGAGCAGTAGGATGTTTTCTTCTTGCGCCAATTTTTCCGGGATT
CGATAGGATGTGGTCTGGCCACACTGGAAGTGGCTGCAAATTCTTATATCGCAGTTCTTGGTACACCCAAGTACG
CTGCAGCGCGGTTGAATTTCAGCCAGGGCTTTCAGGGTCTTGCAGCTTTTGCTGGCCCTTTGATTGCCTCTAAAT
ATTTTTTTCGCGGGGAAAACTCCACGAAACTGGACACTGTGCAATGGTATGAATAAGTATCCAAATTTTACAAAA
TTATTCACACCTACGCTAGGGTTTATCTTGCAGTGGCAGGACTTGGAGTCCTTCTTAATGTCATGTTTTAGTGAG
CATTTCAATTCTTTGTAGTGTAGATCATCCTTACCTATAGCTCTCCTTAGCTTTTGCAAGTTGCCGGAAATCACG
GGAGACGCTCTCGCCGCAGAAATTCATGAAGTTGGTATCCGCGCCGACGAGGAGCCGTTCTGGAAGCAATATAGG
TGTATATTCGGGTTCGTTGCACAGATGGCTTATGTGTACGTTCGTTTGGCTTTGTGCAACCCGACTCAAAGAGCT
AACGGAGTGTCCTTAGAGGAGCTCAAGTCGGTGTCGCATCACTTGCGGTGAACTACTTCTCCGAGCAAGGTCTCG
GGATCGATAGATCGAGGGCCAGCTTCCTATACTCTTTCTGTCAATTGACGTTCATGTTTGGAAGGTGAGAGAATT
GCACAGCAAAAGCATTCGCCTCTAATCGTCACCACTCCATGTTAGGTTTGCTGGTGTAGCCATCCTCCACTTTAT
CGATCCTGCACTGCTACTGTCTTTGTATGCGGTGGCATGTAGCTTATTTACGATACTTACTGGGGTGCTTGGGGG
AAATGGAGGTGTTGGCTCCTTATTCGCCCTATTTTGGTTCGAGTCTATCTGTTATCCGGTCAGTATCTTTGTATC
TCATATGTTTGAGTTCACCGACTGACGAACGGGCTAGTGCATCTTTACTCTGGGTACGAAGAACTTGGGTATTTA
CACTAAACGGGGGTCGGGTCTGATTGTTATGGTCAGCAACAGCGAATAACAGAAAACATTGTTGACTAATTTAAC
TTCTTTTCCAGGGTGTTGGTGGTGGTGCATGGTTCCCTCCGGCACAAGCCAGTCTCGCGGATAAGGTTTCTACCC
GGCGTTCGTACTTGGTCCCACTTGCAGGCTATTTGGCTATGACAATCTACGCAATGTAAGAAGCTTGTTTTTATT
CCGATTTACCCTGCCAATGGCAAAGCTAACCTGTTTCTGCAGCGGCATGGTAGTAGATCAAACTATAAAGGAATC
ATTCAGGTTCCGCAATATTGACGAATTGAAGGAGAGAAGGGCGATGATGGGTGGAGCACCAGAACGAGAGACTCA
AGATATTGACGAAAAGGCAAAAGACACATCCGGCAGCGATGAGATTGAAAAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail