Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043950
Gene name
Locationscaffold_2:1362629..1364450
Strand-
Gene length (bp)1821
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 4.2E-27 59 274
PF11895 Peroxidase_ext Fungal peroxidase extension region 4.0E-27 278 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 16 354 7.0E-144
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 16 354 2.0E-142
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 1 332 1.0E-129
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 1 354 3.0E-116
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 29 346 2.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 16 354 7.0E-144
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 16 354 2.0E-142
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 1 332 1.0E-129
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 1 354 3.0E-116
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 29 346 2.0E-115
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 1 346 3.0E-115
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 1 352 2.0E-110
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 20 332 1.0E-109
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 1 353 4.0E-109
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 1 352 2.0E-108
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 1 352 2.0E-106
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 20 352 9.0E-106
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 1 343 8.0E-105
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 25 352 2.0E-104
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 25 352 9.0E-104
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 25 352 1.0E-103
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 1 352 2.0E-102
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 1 352 2.0E-101
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 29 352 7.0E-88
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 29 352 1.0E-87
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 29 352 3.0E-87
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 46 334 8.0E-69
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 67 294 2.0E-17
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 67 294 2.0E-17
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 67 294 3.0E-17
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 67 294 1.0E-16
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 67 294 2.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 67 294 3.0E-15
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 67 294 1.0E-14
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 67 294 1.0E-14
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 34 294 1.0E-14
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 67 294 1.0E-12
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 66 294 4.0E-12
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 67 310 4.0E-12
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 67 306 5.0E-12
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 67 294 2.0E-11
sp|Q59X94|CCPR2_CANAL Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP2 PE=3 SV=1 67 300 3.0E-11
sp|Q6BIB1|CCPR2_DEBHA Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G12166g PE=3 SV=3 67 297 4.0E-11
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 48 300 4.0E-11
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 67 294 5.0E-11
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 46 294 1.0E-10
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 67 310 1.0E-10
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 67 294 1.0E-10
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 67 300 7.0E-10
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 67 300 7.0E-10
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 67 308 8.0E-10
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 67 294 9.0E-10
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 67 294 1.0E-09
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 67 296 2.0E-09
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 32 294 4.0E-09
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 67 294 4.0E-09
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 67 307 4.0E-09
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 49 294 4.0E-09
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 65 329 1.0E-08
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 67 295 1.0E-08
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 19 290 2.0E-08
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 67 294 2.0E-08
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 67 296 1.0E-07
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 67 321 1.0E-07
sp|P0CP56|CCPR2_CRYNJ Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNE03890 PE=3 SV=1 67 297 2.0E-07
sp|P0CP57|CCPR2_CRYNB Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBE3880 PE=3 SV=1 67 297 2.0E-07
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 108 290 2.0E-06
sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 47 202 2.0E-06
sp|Q43731|PER50_ARATH Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=1 SV=1 66 294 2.0E-06
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 67 296 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0005488 binding No
GO:0006950 response to stress No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0050896 response to stimulus No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043950
MAFKILLSLILALNAVQFIAAVPTRRAQCADGTTVSNEACCVLLPIIADIQPNLFENECGEEVHETLRASFHDAI
GFSRAAGGGGADGSLVTFGDVETTFAANAGIDEIVETLRPFINSHNISAGDFIQFATVVGLTNCPGAPRIPFFLG
RPDATAASPDGLVPEPFDSVTKILERFDDAGFTPTEVVALLASHTVAASDTIEPGLEGVPFDSTPGEFDRQFFIE
TMLKGTSFPGTGGNQGEALSPLPGELRLESDGLLARDERTACDWQLFATDQQKMASAFSDAMVKLSLVGQDKSQL
IDCSDVIPRTIPLTNEPYFPADLTKDDLEQTCPDEFPDYPSNPSVTSVAPVPTS*
Coding >AgabiH97|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTCCAATTTATTGCTGCTGTTCCTACCAGG
AGGGCCCAATGTGCCGATGGCACCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATC
CAGCCGAACTTGTTCGAAAACGAGTGCGGTGAAGAGGTCCATGAAACCTTGCGGGCATCATTTCATGATGCTATC
GGATTCTCCAGAGCAGCTGGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTGGAGACCACATTT
GCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAACATCAGTGCCGGC
GATTTCATCCAGTTTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGC
CGCCCAGACGCTACCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGATTCCGTCACGAAAATTCTTGAA
CGCTTCGATGATGCTGGTTTTACCCCCACTGAAGTTGTTGCATTGCTTGCATCTCATACTGTCGCAGCTTCGGAC
ACAATTGAGCCCGGTCTCGAAGGTGTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAG
ACTATGCTTAAAGGCACTTCCTTCCCAGGCACTGGGGGGAACCAAGGTGAAGCCTTATCTCCCTTGCCGGGAGAA
CTTCGTCTCGAATCCGATGGACTTTTGGCTCGAGATGAACGAACCGCATGTGACTGGCAACTCTTCGCTACTGAT
CAACAAAAAATGGCATCGGCATTTAGCGACGCCATGGTCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTG
ATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTTTGACAAATGAACCATACTTCCCTGCCGACTTGACCAAA
GATGATCTTGAGCAGACCTGCCCGGATGAATTCCCTGATTACCCTTCCAACCCCAGTGTCACTTCGGTCGCGCCA
GTTCCCACCTCGTAA
Transcript >AgabiH97|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTCCAATTTATTGCTGCTGTTCCTACCAGG
AGGGCCCAATGTGCCGATGGCACCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATC
CAGCCGAACTTGTTCGAAAACGAGTGCGGTGAAGAGGTCCATGAAACCTTGCGGGCATCATTTCATGATGCTATC
GGATTCTCCAGAGCAGCTGGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTGGAGACCACATTT
GCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAACATCAGTGCCGGC
GATTTCATCCAGTTTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGC
CGCCCAGACGCTACCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGATTCCGTCACGAAAATTCTTGAA
CGCTTCGATGATGCTGGTTTTACCCCCACTGAAGTTGTTGCATTGCTTGCATCTCATACTGTCGCAGCTTCGGAC
ACAATTGAGCCCGGTCTCGAAGGTGTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAG
ACTATGCTTAAAGGCACTTCCTTCCCAGGCACTGGGGGGAACCAAGGTGAAGCCTTATCTCCCTTGCCGGGAGAA
CTTCGTCTCGAATCCGATGGACTTTTGGCTCGAGATGAACGAACCGCATGTGACTGGCAACTCTTCGCTACTGAT
CAACAAAAAATGGCATCGGCATTTAGCGACGCCATGGTCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTG
ATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTTTGACAAATGAACCATACTTCCCTGCCGACTTGACCAAA
GATGATCTTGAGCAGACCTGCCCGGATGAATTCCCTGATTACCCTTCCAACCCCAGTGTCACTTCGGTCGCGCCA
GTTCCCACCTCGTAA
Gene >AgabiH97|043950
ATGGCTTTCAAAATTCTTCTCAGCCTTATTTTGGCTTTGAACGCCGTCCAATTTATTGCTGGTACGCACTTTACT
CATATCCTCATATTATTTGCCGACAAGTCAACGATGTAGCTGTTCCTACCAGGAGGGCCCAATGTGCCGATGGCA
CCACTGTTTCTAATGAGGCCTGTTGCGTTCTGCTCCCCATTATAGCAGATATCCAGCCGAACTTGTTCGAAAACG
AGTGCGGTGAAGAGGTAATGATTTAATTTTTTGATAGAGTTACGATATTCAACAGCATATTTATACTTTAGGTCC
ATGAAACCTTGCGGGCATCATTTCATGATGCTATCGGATTCTCCAGAGCAGCTGGGTAGGTTCTGACTGTCTGTG
GCGGCAGCTAGTATCGCTAAAATGATTTCCAGTGGTGGTGGTGCTGATGGTTCTCTCGTCACTTTCGGCGATGTG
GAGACCACATTTGCCGCTAACGCAGGAATCGACGAGATTGTAGAGACATTACGACCTTTTATAAACAGCCACAAC
ATCAGTGCCGGCGATTTGTGAGCCTGGACTCATAATCTGTGTTGCATCCTGTTAACGCTCTTCCTAGCATCCAGT
TTGCAACCGTTGTTGGATTGACCAACTGCCCCGGCGCACCTCGCATACCCTTTTTCTTAGGCCGCCCAGACGCTA
CCGCCGCTTCCCCCGATGGTCTTGTCCCTGAGCCCTTCGGTCAGTCTCTCATCAGCCTTTCCGGTATAATCTACA
ACCCAAGTTGATAATCAACAGATTCCGTCACGAAAATTCTTGAACGCTTCGATGATGCTGGTTTTACCCCCACTG
AAGTTGTTGCATTGCTTGCATCGTGAGTCTCTAGAACAAGATCGAGAAATATGTGTCCAATCCCCCCGTAGTCAT
ACTGTCGCAGCTTCGGACACAATTGAGCCCGGTGTAAGTTTATTTCTTCGTCAGTATGCATTCTCATCTCATGAG
CACCTTATTCCAGCTCGAAGGGTAAGACATTCCCTATCAATAAGAAACGTCTCAGTATCCAACGCAACCTCTAGT
GTCCCCTTCGACTCGACTCCCGGAGAATTTGACAGGCAGTTCTTTATCGAGACTATGCTTAAAGGCACTTCCTTC
CCAGGGTAAGTAGTTCGTTGACATTCGTTACGCATCCTAATTTTGGCAAAGCACTGGGGGGAACCAAGGTGAAGC
CTTATCTCCCTTGCCGGGAGAACTTCGTCTCGAATCCGATGGACTTGTACGTATACAGTCTTTTGTTGTCTGAAT
TTGTGATTGTTAACATTATTTATCATTAGTTGGCTCGAGGTCTGTCTTGCTAACAAAAGGCATCTGATAACATTG
AAGGACTAACTTGATCATAGATGAACGAACCGCATGTGACTGGCAACTCTTCGCTAGTAAGAATGTTTGCCAACC
AAGAAGAATAGCTCACCTAAAATTCCACGATAGCTGATCAACAAAAAATGGCATCGGCATTTAGCGACGCCATGG
TCAAACTGTCTCTCGTCGGGCAAGATAAGAGCCAATTGATTGATTGTTCAGACGTCATTCCGCGAACGATCCCTT
TGACAAATGAACCATACTTCCCTGCCGACTTGACCAAAGATGATCTTGAGCAGACCGTGAGTCCAATTGACATTC
ACAATACGATTTCCACTCTGAGCCTGCTTGTTTTTGATACAGTGCCCGGATGAATTCCCTGATTACCCTTCCAAC
CCCAGTGTCACTTCGGTCGCGCCAGTGTAAGTTTATGATCAGCTCCAGACGTCTGCTCTTATTCACTCTGCGCAA
ATATCTAGTCCCACCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail