Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043870
Gene name
Locationscaffold_2:1341186..1343435
Strand+
Gene length (bp)2249
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 2.7E-07 419 443

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38352|SAF1_YEAST SCF-associated factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAF1 PE=1 SV=2 373 516 3.0E-11
sp|Q8BK67|RCC2_MOUSE Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 79 240 5.0E-06
sp|Q9P258|RCC2_HUMAN Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 79 240 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043870
MPTNIVDVPPEILLDNLFPVLPVTDLLSLTVTSKYFLFLCSDETLWYRKLKADYNFDGSGTARRTGWKFIYRGLY
RPKVFVWGEAENSRLGLRQYPGSRSAGVPFPVQLDIPGANIIKLIAGGMSFHALDTRGNMYVWGTLDGTMHSLHL
DGYAAKGKPARNPLKLEMPDPIRSISCGRLHSCSLDIKGRIWNFVNWGRPFRLSSHLLSQPDSEPIQIECGWSFS
SALLKNGEVLVWWPTVGALQEEVDTRFQSMDESGVGEAQARNGIIPCHTWTAAVDPVLLPSLPSLPDIAGIGEDF
RELPPRLIEIGGMDSMIIGLTNYGHVLRFRGLDYEGAIGTSGWQYLPEFSETARICQLSEFSDGNFELPETIKIT
HVSAHFMHFSAFSTGSCSIVLQGEIDTDPDSKPKIIPELQNRDIISVEFGDYHSAALSASGKLYTWGSYSKGALG
LGDPLTLPIGTPGGFANQAQLNGGRGRPPSVTVPTEVRFDHGRRKSKDRFCFSVTAAGWHTGALVIDLEPDENEE
DDKIQFRSQQQQSQDPDSWSTPPIVPQIPARGWGMPFIHRIGFAGRGMHRGQSNRDGASGS*
Coding >AgabiH97|043870
ATGCCTACCAATATCGTCGATGTTCCACCAGAAATTCTTCTCGACAACCTGTTCCCTGTTTTACCAGTCACTGAC
CTTCTCTCGTTGACCGTAACATCAAAGTACTTCTTATTCTTGTGCTCAGATGAAACGCTCTGGTATCGCAAACTC
AAGGCAGACTATAATTTTGATGGATCGGGGACGGCACGACGTACAGGTTGGAAGTTTATCTATAGAGGATTATAT
AGACCCAAAGTGTTTGTATGGGGAGAGGCTGAAAATTCACGATTAGGACTGAGGCAATACCCTGGGTCCAGATCT
GCTGGTGTCCCTTTTCCTGTCCAGCTGGATATCCCTGGAGCCAACATTATCAAGCTCATCGCAGGCGGCATGTCT
TTTCATGCCCTCGACACGCGGGGCAATATGTATGTCTGGGGGACTCTCGATGGGACGATGCATAGTCTTCATCTG
GACGGGTATGCTGCTAAGGGCAAGCCTGCAAGAAATCCTTTGAAATTGGAGATGCCTGACCCAATCAGAAGTATA
AGCTGTGGGCGTCTGCACTCCTGCTCTTTAGATATCAAAGGCAGAATTTGGAACTTTGTTAATTGGGGACGACCC
TTTCGGCTCTCCTCTCACCTTTTGTCTCAGCCTGACTCCGAGCCTATCCAGATTGAATGTGGATGGTCATTCTCG
TCTGCTCTCCTGAAAAATGGTGAAGTTCTCGTTTGGTGGCCCACAGTGGGTGCTCTCCAGGAAGAGGTCGATACG
CGATTCCAAAGTATGGATGAATCAGGGGTCGGGGAAGCACAAGCGAGGAATGGTATTATACCATGCCACACGTGG
ACTGCAGCCGTCGACCCTGTCCTCCTACCTTCATTGCCATCTTTACCTGATATCGCAGGTATCGGCGAGGATTTC
AGGGAACTCCCACCTCGGTTGATTGAAATCGGGGGTATGGACAGCATGATAATTGGACTGACTAACTATGGGCAC
GTCCTCAGATTCCGAGGACTTGATTATGAGGGCGCTATTGGCACTTCAGGTTGGCAATATCTTCCAGAGTTCAGC
GAGACAGCTCGAATTTGCCAACTGTCCGAGTTTTCAGACGGAAATTTTGAACTACCGGAAACTATAAAGATCACC
CATGTCTCCGCCCACTTCATGCATTTCTCTGCGTTCTCGACAGGCTCCTGTTCCATAGTTCTCCAGGGGGAGATT
GATACAGATCCTGACTCCAAACCCAAGATAATACCCGAGCTCCAGAACAGAGACATCATATCTGTTGAATTTGGT
GACTATCATAGTGCTGCCCTTTCAGCAAGTGGGAAATTATACACTTGGGGTTCATATTCAAAGGGAGCGCTGGGT
TTGGGCGATCCATTGACACTGCCAATAGGCACACCGGGTGGGTTTGCAAATCAAGCTCAGTTGAATGGAGGCAGG
GGCAGACCACCAAGTGTCACAGTACCAACAGAGGTGAGATTTGATCATGGGCGGAGAAAGTCCAAGGATAGGTTT
TGCTTTTCTGTCACCGCTGCCGGTTGGCACACGGGAGCTCTAGTCATCGACCTTGAGCCCGACGAAAATGAGGAA
GATGACAAGATTCAATTCCGGTCTCAGCAACAGCAATCGCAAGATCCGGATAGTTGGTCTACTCCGCCGATCGTA
CCTCAGATACCCGCTCGAGGTTGGGGTATGCCTTTTATCCATCGTATTGGGTTCGCTGGGCGTGGAATGCATCGA
GGTCAGTCGAATAGAGATGGAGCTTCGGGCTCATGA
Transcript >AgabiH97|043870
ATGCCTACCAATATCGTCGATGTTCCACCAGAAATTCTTCTCGACAACCTGTTCCCTGTTTTACCAGTCACTGAC
CTTCTCTCGTTGACCGTAACATCAAAGTACTTCTTATTCTTGTGCTCAGATGAAACGCTCTGGTATCGCAAACTC
AAGGCAGACTATAATTTTGATGGATCGGGGACGGCACGACGTACAGGTTGGAAGTTTATCTATAGAGGATTATAT
AGACCCAAAGTGTTTGTATGGGGAGAGGCTGAAAATTCACGATTAGGACTGAGGCAATACCCTGGGTCCAGATCT
GCTGGTGTCCCTTTTCCTGTCCAGCTGGATATCCCTGGAGCCAACATTATCAAGCTCATCGCAGGCGGCATGTCT
TTTCATGCCCTCGACACGCGGGGCAATATGTATGTCTGGGGGACTCTCGATGGGACGATGCATAGTCTTCATCTG
GACGGGTATGCTGCTAAGGGCAAGCCTGCAAGAAATCCTTTGAAATTGGAGATGCCTGACCCAATCAGAAGTATA
AGCTGTGGGCGTCTGCACTCCTGCTCTTTAGATATCAAAGGCAGAATTTGGAACTTTGTTAATTGGGGACGACCC
TTTCGGCTCTCCTCTCACCTTTTGTCTCAGCCTGACTCCGAGCCTATCCAGATTGAATGTGGATGGTCATTCTCG
TCTGCTCTCCTGAAAAATGGTGAAGTTCTCGTTTGGTGGCCCACAGTGGGTGCTCTCCAGGAAGAGGTCGATACG
CGATTCCAAAGTATGGATGAATCAGGGGTCGGGGAAGCACAAGCGAGGAATGGTATTATACCATGCCACACGTGG
ACTGCAGCCGTCGACCCTGTCCTCCTACCTTCATTGCCATCTTTACCTGATATCGCAGGTATCGGCGAGGATTTC
AGGGAACTCCCACCTCGGTTGATTGAAATCGGGGGTATGGACAGCATGATAATTGGACTGACTAACTATGGGCAC
GTCCTCAGATTCCGAGGACTTGATTATGAGGGCGCTATTGGCACTTCAGGTTGGCAATATCTTCCAGAGTTCAGC
GAGACAGCTCGAATTTGCCAACTGTCCGAGTTTTCAGACGGAAATTTTGAACTACCGGAAACTATAAAGATCACC
CATGTCTCCGCCCACTTCATGCATTTCTCTGCGTTCTCGACAGGCTCCTGTTCCATAGTTCTCCAGGGGGAGATT
GATACAGATCCTGACTCCAAACCCAAGATAATACCCGAGCTCCAGAACAGAGACATCATATCTGTTGAATTTGGT
GACTATCATAGTGCTGCCCTTTCAGCAAGTGGGAAATTATACACTTGGGGTTCATATTCAAAGGGAGCGCTGGGT
TTGGGCGATCCATTGACACTGCCAATAGGCACACCGGGTGGGTTTGCAAATCAAGCTCAGTTGAATGGAGGCAGG
GGCAGACCACCAAGTGTCACAGTACCAACAGAGGTGAGATTTGATCATGGGCGGAGAAAGTCCAAGGATAGGTTT
TGCTTTTCTGTCACCGCTGCCGGTTGGCACACGGGAGCTCTAGTCATCGACCTTGAGCCCGACGAAAATGAGGAA
GATGACAAGATTCAATTCCGGTCTCAGCAACAGCAATCGCAAGATCCGGATAGTTGGTCTACTCCGCCGATCGTA
CCTCAGATACCCGCTCGAGGTTGGGGTATGCCTTTTATCCATCGTATTGGGTTCGCTGGGCGTGGAATGCATCGA
GGTCAGTCGAATAGAGATGGAGCTTCGGGCTCATGA
Gene >AgabiH97|043870
ATGCCTACCAATATCGTCGATGTTCCACCAGAAATTCTTCTCGACAACCTGTTCCCTGTTTTACCAGTCACTGAC
CTTCTCTCGTTGACCGTAACATCAAAGGTGGTTAATATCTCGACCCACGAAAAGATGAAGCTTTAACCGCCGAGT
CATGTTCATCCTCTAGTACTTCTTATTCTTGTGCTCAGATGAAACGCTCTGGTATCGCAAACTCAAGGCAGACTA
TAATTTTGATGGATCGGGGACGGCACGACGTACAGGTTGGAAGTTTATCTATAGAGGATTATATAGACCCAAAGG
TAACATCTACCCTGCTGCGACATAAATGTTTTAATTTCTTCATTGCAGTGTTTGTATGGGGGTGAGTTCTATCAC
CTGGTACTCATAGCATTCGTCGCCGAGTTGACTATTCTGTAGAGAGGCTGAAAATTCACGATTAGGACTGAGGCA
ATACCCTGGGTCCAGATCTGCTGGTGTCCCTTTTCCTGTCCAGCTGGATATCCCTGGAGCCAACATTATCAAGCT
CATCGCAGGCGGCATGTGGGTGCACTACTCTTTCTAATGTTTATATTGTCCACATTGCGTTTCAAGGTCTTTTCA
TGCCCTCGACACGCGGGGCAATATGTATGTCTGGGGTATGTGCGGGGCCCTTTCTCAGGCATTTTAGCCACTCAT
ACTGAAAGGAACAGGGACTCTCGATGGGACGATGCATAGTCTTCATCTGGACGGGTATGCTGCTAAGGGCAAGCC
TGCAAGAAATCCTTTGAAATTGGAGATGCCTGACCCAATCAGAAGTATAAGGTAAATACAGCATTTATTTGACAT
GCGTATTGAGTCTTTGATTGTCGCTGTAGCTGTGGGCGTCTGCACTCCTGCTCTTTAGATATCAAAGGCAGAATT
TGGAACTTTGTTAATTGGGGACGACCCTTTCGGCTCTCCTCTCACCTTTTGTCTCAGCCTGACTCCGAGCCTATC
CAGATTGAATGTGGATGGTCATTCTCGTCTGCTCTCCTGAAAAATGGTGAAGTTCTCGTTTGGTGGCCCACAGTG
GGTGCTCTCCAGGAAGAGGTCGATACGCGATTCCAAAGTATGGATGAATCAGGGGTCGGGGAAGCACAAGCGAGG
AATGGTATTATACCATGCCACACGTGGACTGCAGCCGTCGACCCTGTCCTCCTACCTTCATTGCCATCTTTACCT
GATATCGCAGGTATCGGCGAGGATTTCAGGGAACTCCCACCTCGGTTGATTGAAATCGGGGGTATGGACAGCATG
ATAATTGGACTGACTAACTATGGGCACGTCCTCAGATTCCGAGGACTTGATTATGAGGGCGCTATTGGCACTTCA
GGTTGGCAATATGTATGTCCACCGATAGGTATATGAACACCTCTGATGTCCAAACTAGCTTCCAGAGTTCAGCGA
GACAGCTCGAATTTGCCAACTGTCCGAGTTTTCAGACGGAAATTTTGAACTACCGGAAACTATAAAGATCACCCA
TGTCAGTATTCGTCTTTACGCTCATAAATGTCTCAATCTTTTAACCAACTCCACCTTTCAGGTCTCCGCCCACTT
CATGCATTTCTCTGCGTTCTCGACAGGCTCCTGTTCCATAGTTCTCCAGGGGGAGATTGATACAGATCCTGACTC
CAAACCCAAGATAATACCCGAGCTCCAGAACAGAGACATCATATCTGTTGAATTTGGTGACTATCATAGTGCTGC
CCTTTCAGCAAGTGGGAAATTATACACTTGGGGTTCATATTCAAAGGGAGCGCTGGGTTTGGGCGATCCATTGAC
ACTGCCAATAGGCACACCGGGTGGGTTTGCAAATCAAGCTCAGTTGAATGGAGGCAGGGGCAGACCACCAAGTGT
CACAGTACCAACAGAGGTGAGATTTGATCATGGGCGGAGAAAGTCCAAGGATAGGTTTTGCTTTTCTGTCACCGC
TGCCGGTTGGCACACGGGAGCTCTAGTCATCGACCTTGAGGTGTGTCGATTCCCCACTTTGATCGATAGATAGTC
ATTAGAGCCCTTTCGTATAGCCCGACGAAAATGAGGAAGATGACAAGATTCAATTCCGGTCTCAGCAACAGCAAT
CGCAAGATCCGGATAGTTGGTCTACTCCGCCGATCGTACCTCAGATACCCGCTCGAGGTTGGGGTATGCCTTTTA
TCCATCGTATTGGGTTCGCTGGGCGTGGAATGCATCGAGGTCAGTCGAATAGAGATGGAGCTTCGGGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail