Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043840
Gene name
Locationscaffold_2:1330135..1335990
Strand-
Gene length (bp)5855
Transcript length (bp)4911
Coding sequence length (bp)4911
Protein length (aa) 1637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09497 Med12 Transcription mediator complex subunit Med12 8.3E-24 109 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P456|SRB8_USTMA Mediator of RNA polymerase II transcription subunit 12 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SRB8 PE=3 SV=1 3 663 1.0E-45
sp|Q2U513|SRB8_ASPOR Mediator of RNA polymerase II transcription subunit 12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb8 PE=3 SV=2 5 632 2.0E-33
sp|Q1EAK2|SRB8_COCIM Mediator of RNA polymerase II transcription subunit 12 OS=Coccidioides immitis (strain RS) GN=SRB8 PE=3 SV=2 21 555 8.0E-33
sp|Q0V6H6|SRB8_PHANO Mediator of RNA polymerase II transcription subunit 12 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SRB8 PE=3 SV=1 3 623 1.0E-32
sp|Q5B3Y9|SRB8_EMENI Mediator of RNA polymerase II transcription subunit 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb8 PE=3 SV=2 35 625 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P456|SRB8_USTMA Mediator of RNA polymerase II transcription subunit 12 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SRB8 PE=3 SV=1 3 663 1.0E-45
sp|Q2U513|SRB8_ASPOR Mediator of RNA polymerase II transcription subunit 12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb8 PE=3 SV=2 5 632 2.0E-33
sp|Q1EAK2|SRB8_COCIM Mediator of RNA polymerase II transcription subunit 12 OS=Coccidioides immitis (strain RS) GN=SRB8 PE=3 SV=2 21 555 8.0E-33
sp|Q0V6H6|SRB8_PHANO Mediator of RNA polymerase II transcription subunit 12 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SRB8 PE=3 SV=1 3 623 1.0E-32
sp|Q5B3Y9|SRB8_EMENI Mediator of RNA polymerase II transcription subunit 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb8 PE=3 SV=2 35 625 2.0E-32
sp|A1D887|SRB8_NEOFI Mediator of RNA polymerase II transcription subunit 12 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb8 PE=3 SV=1 13 623 7.0E-32
sp|Q7SGG0|SRB8_NEUCR Mediator of RNA polymerase II transcription subunit 12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=srb8 PE=3 SV=1 29 894 7.0E-32
sp|Q4WWL0|SRB8_ASPFU Mediator of RNA polymerase II transcription subunit 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb8 PE=3 SV=2 13 623 9.0E-32
sp|A1CJ92|SRB8_ASPCL Mediator of RNA polymerase II transcription subunit 12 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb8 PE=3 SV=1 35 634 5.0E-31
sp|Q0CBX9|SRB8_ASPTN Mediator of RNA polymerase II transcription subunit 12 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=srb8 PE=3 SV=2 13 638 5.0E-31
sp|Q6C229|SRB8_YARLI Mediator of RNA polymerase II transcription subunit 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB8 PE=3 SV=2 28 627 4.0E-22
sp|Q6BUQ1|SRB8_DEBHA Mediator of RNA polymerase II transcription subunit 12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SRB8 PE=3 SV=2 26 269 1.0E-15
sp|A3GF47|SRB8_PICST Mediator of RNA polymerase II transcription subunit 12 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SRB8 PE=3 SV=2 29 273 2.0E-15
sp|Q6FVM9|SRB8_CANGA Mediator of RNA polymerase II transcription subunit 12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SRB8 PE=3 SV=1 32 415 2.0E-15
sp|Q751D2|SRB8_ASHGO Mediator of RNA polymerase II transcription subunit 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SRB8 PE=3 SV=2 32 273 3.0E-14
sp|P25648|SRB8_YEAST Mediator of RNA polymerase II transcription subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB8 PE=1 SV=2 32 273 5.0E-14
sp|Q9P6L8|SRB8_SCHPO Mediator of RNA polymerase II transcription subunit 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srb8 PE=1 SV=2 37 207 2.0E-13
sp|Q6CKZ5|SRB8_KLULA Mediator of RNA polymerase II transcription subunit 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SRB8 PE=3 SV=1 32 273 5.0E-11
sp|Q8BQM9|MD12L_MOUSE Mediator of RNA polymerase II transcription subunit 12-like protein OS=Mus musculus GN=Med12l PE=1 SV=2 30 273 5.0E-08
sp|Q2QCI8|MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio GN=med12 PE=2 SV=1 30 273 6.0E-08
sp|Q54U49|MED12_DICDI Putative mediator of RNA polymerase II transcription subunit 12 OS=Dictyostelium discoideum GN=med12 PE=3 SV=2 10 319 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0140513 nuclear protein-containing complex No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:0140110 transcription regulator activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043840
MPGRKDENNLPLYESQPPSWLPKSHATADLGYPGFFPTKPGQDEDVLSDSRVRSGFVLGHQVSAETFSAQAIINE
NLNAGDTLNQLESLINEVFKRRADRIPPIPSSTFRLPTRVTLNEARKQTWFADLANPDVPLHRLRKNVPHLAKGH
DMLDLLHQNNVAIPRAIWFLRVSGANETTGLRGGKGKGSYNPTQYSIDWANVMTGYMKKQLADIALPSAPRPGLN
IKQTFKGVLADAEGREKWISRFSYCLMLLRTFYAEGLVDHRTFLVWFVHQMGVCNLAQAGFLSRLADEYLNPILI
SRALARPFVDACLNKLAEIRNTAQEYLADTEKQFCVILQRICLALPDAFVCPRMWLAHSAMIADVMAADIIQFPP
GIECSTDRAVREIRRSISDNLFDIKKRNEAILFLDPPSKGVGRLYMTIMDVKLLNSISAMTDMTTVSFFQNELDN
TPAFQEKLDMLLTWSVTTLQYGDHRPFAAVTLIRLWRDRACERATRRGTETPSDFLQDQLFDWLDISEVAEEAKH
LRSIALLYGELIKEELFSYSKYIQRLIARGEPGLSFTETAISRHRQFLRWIPLHKSVSPEVNQRKVTLYDLKARS
TPEDTAEREIRQEIRLILPELFGGETDFDVTTSVTLLDQSKILMNAPRFEQARSIRDWFLPKLRELACRPHSAVT
GSSLLRIYCISVEVMSYVKCFDSLLDFTLWVLANTKYPELLVAIIDTLHRFATIWSCMNIKRDIVLALDSAHQAS
KSRGIQSRGLLSLLVEFDRDKSYLSPASRERIDSDLCHFTLALRPVTEHPESVPDRLTEILLMAADTAADAPSLL
ANGLWIKYRTSLDWAWKVWDNTIASLRQVPLMNSDTTQRKACALRYGMFLWQVNQHLPDGLDGDVQRWFAGPGQN
EIAALTAEAWQVVTVSLLYLCIHGALKSTTILTGVVYPAWQLGATESTPEVHVFLTSANNLFRQLLLQETPNTTG
IPPVDLFDVQCLQTRRRTVYEEPHFSCLVKSIPLLILLENKLDIPQEIRAEFTSLRHQLCHGNQFRQGAYRSLDV
IRAAFEDYPPLPEQSSANLGQNIIAGLRTILGDNVDEKNMYHWPEVTCLLSPWKIVATTIQMQFSVKQLGKALTQ
EATHEAASSNLNKLSIMLFHQSMTSEEAYYVGEMAQGADSTVASKFIANGFKCINELLQEFISEQMTKALDKLRR
VGEVLHALVYIAQPFRKEGALVLYLDPVVQDDFVAILHNKLSEIITTLEPSASAQIDQSAQISQQIILLVRLLQF
DLGFRGAWTPKMKDLSGGFIRNLFHLALYFGAPDHLNPVVYPLLVDTLLFIIDEIPQPAKPLSFDPFRHYPNTLT
SDIPTDLPLEYRKQILSLLSSLSTSCAVTNLVASNLLQEQPVVNQPWEWIENLDEASTLDGSSKDEDLDRQEKAR
LKTRYLVKNSGSLSLENFRAQMTGDGVVELLATDYDAQALNDIRTFEDGLAAEGIFARDWRESRIDVDESISSPT
SVSSGRAMQSQSAGGGAGSGDGDQESGSSSSHAKTERKLTPMRASPASSIVSRSSAKGSTSSWKQQSPTMRLVGE
GNDAEGPSRGVAKRKMDDGDDEVEAIERPVPSHTAPPTKRARAGAGKTTGKTAGKPRAKKR*
Coding >AgabiH97|043840
ATGCCTGGACGCAAAGATGAAAACAACCTTCCACTGTATGAATCTCAACCCCCATCATGGCTCCCCAAATCGCAT
GCCACAGCTGACCTCGGTTACCCTGGGTTCTTCCCGACAAAGCCCGGCCAGGACGAGGATGTGCTATCTGATTCC
AGAGTCAGGTCTGGCTTCGTCCTAGGGCATCAAGTGTCAGCGGAAACCTTCAGCGCTCAGGCAATTATAAACGAA
AACTTGAATGCCGGGGACACGTTGAATCAGTTGGAAAGTTTAATTAACGAAGTCTTTAAGCGTCGTGCCGACCGG
ATACCCCCCATCCCCTCTTCGACCTTTCGCCTGCCTACGAGGGTGACTCTCAATGAAGCGAGAAAACAAACATGG
TTTGCCGACCTCGCAAATCCCGACGTCCCATTGCACAGGCTCAGGAAAAATGTACCCCATCTAGCGAAAGGTCAT
GATATGCTGGATTTGTTGCACCAGAACAATGTCGCCATACCCAGAGCGATTTGGTTTCTTCGCGTATCTGGTGCC
AATGAGACTACTGGATTGCGAGGCGGAAAAGGAAAGGGTTCCTATAATCCAACACAGTACAGCATTGATTGGGCA
AACGTCATGACTGGATATATGAAAAAACAGCTCGCCGATATTGCATTGCCAAGTGCTCCACGCCCTGGACTCAAC
ATCAAACAAACCTTCAAGGGTGTTCTCGCTGATGCCGAAGGAAGAGAGAAGTGGATCTCACGCTTTTCCTACTGT
CTGATGCTCTTGCGAACGTTTTACGCTGAAGGCCTTGTAGATCACAGGACGTTCCTTGTGTGGTTTGTGCATCAA
ATGGGTGTTTGCAATCTTGCACAGGCTGGATTTTTGAGCCGTCTGGCGGATGAATATTTGAATCCAATTTTGATC
AGTCGTGCTCTTGCTAGACCATTTGTGGACGCATGTCTCAATAAATTAGCTGAGATCCGCAACACAGCACAAGAG
TACCTGGCTGACACGGAGAAGCAGTTTTGCGTGATACTTCAACGTATCTGTCTGGCACTTCCAGATGCGTTCGTT
TGTCCTCGTATGTGGCTGGCGCATTCTGCAATGATCGCCGATGTCATGGCCGCCGACATCATCCAGTTTCCTCCT
GGCATTGAATGTTCTACAGATCGTGCCGTTCGAGAAATCCGACGTTCTATAAGCGATAATCTTTTCGACATAAAA
AAACGAAACGAGGCTATCCTGTTTTTGGATCCCCCTTCGAAAGGGGTCGGACGCCTGTACATGACAATCATGGAC
GTGAAGCTGCTTAACTCTATTTCTGCGATGACAGACATGACAACAGTAAGCTTTTTCCAGAATGAGCTGGACAAT
ACACCAGCTTTTCAAGAAAAACTGGATATGCTCCTCACCTGGAGTGTCACTACTTTGCAATATGGTGACCACCGC
CCCTTTGCTGCTGTCACGCTCATTCGTCTGTGGAGAGATAGGGCCTGCGAACGTGCAACTCGTCGTGGTACCGAG
ACTCCCAGTGATTTTTTGCAAGATCAGCTATTTGATTGGTTAGACATATCAGAAGTCGCTGAAGAGGCAAAACAT
CTGCGGAGTATTGCTCTTCTTTATGGAGAATTGATCAAAGAAGAACTGTTTTCCTATTCGAAGTACATACAGAGG
TTGATCGCGCGAGGGGAACCTGGATTATCCTTTACCGAAACGGCGATATCCAGGCATCGCCAATTTTTGCGCTGG
ATTCCCCTGCACAAATCTGTTTCCCCGGAAGTGAACCAGAGGAAGGTCACCCTCTATGATTTAAAGGCTAGAAGT
ACCCCTGAAGATACCGCAGAACGGGAGATCCGTCAAGAGATCCGTCTAATCCTTCCTGAACTTTTTGGCGGAGAA
ACTGACTTCGATGTCACCACTTCTGTTACGTTATTGGACCAAAGCAAGATACTTATGAATGCTCCTCGGTTTGAA
CAAGCGCGCAGTATACGGGACTGGTTTCTCCCAAAGCTACGAGAACTAGCATGCAGACCTCATTCTGCCGTTACG
GGCTCCTCTCTTTTGCGTATCTATTGTATATCTGTGGAAGTAATGTCCTATGTGAAATGCTTTGATTCTCTCCTC
GATTTTACGCTCTGGGTCCTTGCGAACACAAAATATCCGGAGTTGCTAGTTGCTATTATTGATACCCTCCATCGT
TTTGCGACCATATGGTCATGTATGAATATCAAGCGAGATATTGTCCTCGCCCTCGATTCGGCTCATCAAGCCTCG
AAAAGTAGGGGTATACAATCAAGGGGTTTACTTTCACTACTTGTTGAATTCGACCGAGATAAATCATATCTCAGC
CCGGCGTCGCGGGAGCGCATTGACTCTGATCTGTGTCATTTTACACTGGCTTTGAGACCAGTTACCGAACACCCT
GAGTCTGTGCCAGATCGCCTTACTGAAATCCTCTTGATGGCGGCCGATACGGCAGCAGATGCACCTTCACTACTT
GCCAATGGTCTTTGGATCAAATATCGCACTTCTCTCGACTGGGCCTGGAAGGTGTGGGACAATACAATCGCGAGT
TTGCGTCAGGTTCCGTTGATGAACTCTGATACCACTCAGCGGAAGGCCTGTGCTCTGCGGTATGGTATGTTCCTT
TGGCAAGTCAATCAGCACCTCCCCGACGGTTTAGATGGTGACGTCCAGAGATGGTTCGCGGGTCCCGGCCAAAAC
GAAATAGCTGCCTTGACTGCCGAGGCTTGGCAGGTCGTCACAGTATCATTATTGTATCTGTGTATTCACGGAGCG
CTGAAGTCCACAACTATCTTGACGGGTGTAGTTTATCCTGCGTGGCAACTCGGAGCTACAGAGTCGACCCCAGAA
GTTCATGTTTTCCTCACCTCCGCCAACAACCTCTTCCGACAACTATTGTTGCAAGAAACTCCTAACACTACAGGG
ATACCTCCGGTCGACCTCTTTGACGTTCAGTGCCTCCAGACTAGGCGGCGGACAGTCTATGAGGAACCACATTTC
TCATGCCTCGTCAAAAGCATTCCTCTCCTAATCCTCCTAGAGAACAAACTCGACATCCCACAGGAGATCAGGGCT
GAATTTACCTCACTTCGACACCAGCTGTGTCACGGTAACCAATTTCGTCAGGGAGCGTACAGGAGCTTAGATGTA
ATTCGAGCAGCTTTCGAAGACTATCCCCCCCTACCTGAACAGTCTTCAGCCAATTTGGGCCAAAACATCATAGCC
GGTCTTAGGACTATCCTTGGAGACAATGTTGATGAAAAAAATATGTATCATTGGCCCGAAGTAACCTGTCTACTT
AGCCCTTGGAAAATCGTCGCCACGACTATTCAGATGCAATTCTCAGTCAAACAGCTAGGGAAGGCGCTTACACAG
GAAGCCACGCATGAGGCAGCAAGTAGCAATCTAAACAAATTGTCAATCATGCTTTTTCATCAATCGATGACTTCG
GAAGAGGCTTACTATGTTGGGGAGATGGCACAAGGGGCTGATAGCACCGTCGCCAGCAAATTCATAGCGAATGGT
TTCAAATGCATCAATGAGCTGCTTCAGGAATTCATATCCGAACAGATGACCAAAGCACTTGACAAGCTCCGACGC
GTTGGGGAGGTGCTGCACGCGCTGGTTTATATCGCTCAGCCTTTTAGAAAGGAAGGAGCTCTGGTCCTGTATCTC
GATCCTGTGGTCCAAGATGATTTCGTGGCAATCCTTCACAATAAACTTTCTGAAATTATAACCACCCTGGAGCCG
AGCGCGTCTGCCCAAATCGATCAATCAGCACAAATCTCACAGCAGATTATCTTACTAGTTCGACTGTTACAGTTC
GACCTTGGTTTCCGCGGGGCATGGACCCCGAAAATGAAGGACCTTAGTGGCGGGTTCATCAGAAATCTCTTCCAT
CTTGCTCTGTATTTTGGTGCCCCAGACCACCTCAATCCTGTCGTTTATCCACTCCTCGTTGATACATTGTTATTT
ATCATTGATGAAATTCCACAGCCCGCAAAACCGCTTTCCTTCGATCCTTTCCGACACTACCCAAACACATTGACT
TCTGATATCCCGACCGATCTCCCGTTAGAATATCGAAAGCAGATACTCTCGCTGCTTTCATCTCTTTCAACTAGT
TGCGCCGTGACCAATCTCGTTGCTTCCAACCTTTTGCAGGAACAACCAGTCGTTAATCAACCCTGGGAATGGATT
GAAAACTTGGATGAAGCATCCACGCTCGATGGATCCAGTAAAGATGAAGATCTTGATCGTCAGGAAAAGGCTCGG
CTCAAAACGCGGTACCTGGTGAAAAACTCAGGTTCCTTGTCTCTGGAAAATTTTCGTGCACAGATGACAGGGGAC
GGTGTTGTTGAACTTCTTGCAACAGACTACGATGCTCAAGCGCTGAATGATATACGGACTTTCGAGGATGGTCTA
GCCGCCGAGGGTATTTTTGCTCGTGATTGGAGGGAAAGTAGGATTGATGTTGATGAGTCGATATCGTCTCCTACC
TCGGTTTCAAGCGGACGCGCTATGCAGAGCCAAAGTGCTGGAGGTGGAGCTGGTAGTGGTGATGGAGATCAAGAA
TCTGGATCGTCCTCCAGTCATGCGAAGACTGAGAGGAAATTGACTCCTATGCGAGCGTCTCCAGCTTCTTCAATT
GTATCGCGAAGTTCCGCGAAGGGATCCACATCGTCATGGAAGCAACAGAGCCCGACTATGAGATTGGTCGGCGAA
GGTAATGATGCGGAGGGCCCTTCACGAGGTGTGGCCAAACGAAAAATGGATGATGGCGATGATGAAGTTGAGGCT
ATCGAACGTCCTGTTCCTAGTCATACCGCTCCACCCACCAAGCGCGCTAGAGCAGGCGCAGGAAAGACAACCGGG
AAGACCGCCGGAAAACCAAGGGCAAAGAAACGGTAA
Transcript >AgabiH97|043840
ATGCCTGGACGCAAAGATGAAAACAACCTTCCACTGTATGAATCTCAACCCCCATCATGGCTCCCCAAATCGCAT
GCCACAGCTGACCTCGGTTACCCTGGGTTCTTCCCGACAAAGCCCGGCCAGGACGAGGATGTGCTATCTGATTCC
AGAGTCAGGTCTGGCTTCGTCCTAGGGCATCAAGTGTCAGCGGAAACCTTCAGCGCTCAGGCAATTATAAACGAA
AACTTGAATGCCGGGGACACGTTGAATCAGTTGGAAAGTTTAATTAACGAAGTCTTTAAGCGTCGTGCCGACCGG
ATACCCCCCATCCCCTCTTCGACCTTTCGCCTGCCTACGAGGGTGACTCTCAATGAAGCGAGAAAACAAACATGG
TTTGCCGACCTCGCAAATCCCGACGTCCCATTGCACAGGCTCAGGAAAAATGTACCCCATCTAGCGAAAGGTCAT
GATATGCTGGATTTGTTGCACCAGAACAATGTCGCCATACCCAGAGCGATTTGGTTTCTTCGCGTATCTGGTGCC
AATGAGACTACTGGATTGCGAGGCGGAAAAGGAAAGGGTTCCTATAATCCAACACAGTACAGCATTGATTGGGCA
AACGTCATGACTGGATATATGAAAAAACAGCTCGCCGATATTGCATTGCCAAGTGCTCCACGCCCTGGACTCAAC
ATCAAACAAACCTTCAAGGGTGTTCTCGCTGATGCCGAAGGAAGAGAGAAGTGGATCTCACGCTTTTCCTACTGT
CTGATGCTCTTGCGAACGTTTTACGCTGAAGGCCTTGTAGATCACAGGACGTTCCTTGTGTGGTTTGTGCATCAA
ATGGGTGTTTGCAATCTTGCACAGGCTGGATTTTTGAGCCGTCTGGCGGATGAATATTTGAATCCAATTTTGATC
AGTCGTGCTCTTGCTAGACCATTTGTGGACGCATGTCTCAATAAATTAGCTGAGATCCGCAACACAGCACAAGAG
TACCTGGCTGACACGGAGAAGCAGTTTTGCGTGATACTTCAACGTATCTGTCTGGCACTTCCAGATGCGTTCGTT
TGTCCTCGTATGTGGCTGGCGCATTCTGCAATGATCGCCGATGTCATGGCCGCCGACATCATCCAGTTTCCTCCT
GGCATTGAATGTTCTACAGATCGTGCCGTTCGAGAAATCCGACGTTCTATAAGCGATAATCTTTTCGACATAAAA
AAACGAAACGAGGCTATCCTGTTTTTGGATCCCCCTTCGAAAGGGGTCGGACGCCTGTACATGACAATCATGGAC
GTGAAGCTGCTTAACTCTATTTCTGCGATGACAGACATGACAACAGTAAGCTTTTTCCAGAATGAGCTGGACAAT
ACACCAGCTTTTCAAGAAAAACTGGATATGCTCCTCACCTGGAGTGTCACTACTTTGCAATATGGTGACCACCGC
CCCTTTGCTGCTGTCACGCTCATTCGTCTGTGGAGAGATAGGGCCTGCGAACGTGCAACTCGTCGTGGTACCGAG
ACTCCCAGTGATTTTTTGCAAGATCAGCTATTTGATTGGTTAGACATATCAGAAGTCGCTGAAGAGGCAAAACAT
CTGCGGAGTATTGCTCTTCTTTATGGAGAATTGATCAAAGAAGAACTGTTTTCCTATTCGAAGTACATACAGAGG
TTGATCGCGCGAGGGGAACCTGGATTATCCTTTACCGAAACGGCGATATCCAGGCATCGCCAATTTTTGCGCTGG
ATTCCCCTGCACAAATCTGTTTCCCCGGAAGTGAACCAGAGGAAGGTCACCCTCTATGATTTAAAGGCTAGAAGT
ACCCCTGAAGATACCGCAGAACGGGAGATCCGTCAAGAGATCCGTCTAATCCTTCCTGAACTTTTTGGCGGAGAA
ACTGACTTCGATGTCACCACTTCTGTTACGTTATTGGACCAAAGCAAGATACTTATGAATGCTCCTCGGTTTGAA
CAAGCGCGCAGTATACGGGACTGGTTTCTCCCAAAGCTACGAGAACTAGCATGCAGACCTCATTCTGCCGTTACG
GGCTCCTCTCTTTTGCGTATCTATTGTATATCTGTGGAAGTAATGTCCTATGTGAAATGCTTTGATTCTCTCCTC
GATTTTACGCTCTGGGTCCTTGCGAACACAAAATATCCGGAGTTGCTAGTTGCTATTATTGATACCCTCCATCGT
TTTGCGACCATATGGTCATGTATGAATATCAAGCGAGATATTGTCCTCGCCCTCGATTCGGCTCATCAAGCCTCG
AAAAGTAGGGGTATACAATCAAGGGGTTTACTTTCACTACTTGTTGAATTCGACCGAGATAAATCATATCTCAGC
CCGGCGTCGCGGGAGCGCATTGACTCTGATCTGTGTCATTTTACACTGGCTTTGAGACCAGTTACCGAACACCCT
GAGTCTGTGCCAGATCGCCTTACTGAAATCCTCTTGATGGCGGCCGATACGGCAGCAGATGCACCTTCACTACTT
GCCAATGGTCTTTGGATCAAATATCGCACTTCTCTCGACTGGGCCTGGAAGGTGTGGGACAATACAATCGCGAGT
TTGCGTCAGGTTCCGTTGATGAACTCTGATACCACTCAGCGGAAGGCCTGTGCTCTGCGGTATGGTATGTTCCTT
TGGCAAGTCAATCAGCACCTCCCCGACGGTTTAGATGGTGACGTCCAGAGATGGTTCGCGGGTCCCGGCCAAAAC
GAAATAGCTGCCTTGACTGCCGAGGCTTGGCAGGTCGTCACAGTATCATTATTGTATCTGTGTATTCACGGAGCG
CTGAAGTCCACAACTATCTTGACGGGTGTAGTTTATCCTGCGTGGCAACTCGGAGCTACAGAGTCGACCCCAGAA
GTTCATGTTTTCCTCACCTCCGCCAACAACCTCTTCCGACAACTATTGTTGCAAGAAACTCCTAACACTACAGGG
ATACCTCCGGTCGACCTCTTTGACGTTCAGTGCCTCCAGACTAGGCGGCGGACAGTCTATGAGGAACCACATTTC
TCATGCCTCGTCAAAAGCATTCCTCTCCTAATCCTCCTAGAGAACAAACTCGACATCCCACAGGAGATCAGGGCT
GAATTTACCTCACTTCGACACCAGCTGTGTCACGGTAACCAATTTCGTCAGGGAGCGTACAGGAGCTTAGATGTA
ATTCGAGCAGCTTTCGAAGACTATCCCCCCCTACCTGAACAGTCTTCAGCCAATTTGGGCCAAAACATCATAGCC
GGTCTTAGGACTATCCTTGGAGACAATGTTGATGAAAAAAATATGTATCATTGGCCCGAAGTAACCTGTCTACTT
AGCCCTTGGAAAATCGTCGCCACGACTATTCAGATGCAATTCTCAGTCAAACAGCTAGGGAAGGCGCTTACACAG
GAAGCCACGCATGAGGCAGCAAGTAGCAATCTAAACAAATTGTCAATCATGCTTTTTCATCAATCGATGACTTCG
GAAGAGGCTTACTATGTTGGGGAGATGGCACAAGGGGCTGATAGCACCGTCGCCAGCAAATTCATAGCGAATGGT
TTCAAATGCATCAATGAGCTGCTTCAGGAATTCATATCCGAACAGATGACCAAAGCACTTGACAAGCTCCGACGC
GTTGGGGAGGTGCTGCACGCGCTGGTTTATATCGCTCAGCCTTTTAGAAAGGAAGGAGCTCTGGTCCTGTATCTC
GATCCTGTGGTCCAAGATGATTTCGTGGCAATCCTTCACAATAAACTTTCTGAAATTATAACCACCCTGGAGCCG
AGCGCGTCTGCCCAAATCGATCAATCAGCACAAATCTCACAGCAGATTATCTTACTAGTTCGACTGTTACAGTTC
GACCTTGGTTTCCGCGGGGCATGGACCCCGAAAATGAAGGACCTTAGTGGCGGGTTCATCAGAAATCTCTTCCAT
CTTGCTCTGTATTTTGGTGCCCCAGACCACCTCAATCCTGTCGTTTATCCACTCCTCGTTGATACATTGTTATTT
ATCATTGATGAAATTCCACAGCCCGCAAAACCGCTTTCCTTCGATCCTTTCCGACACTACCCAAACACATTGACT
TCTGATATCCCGACCGATCTCCCGTTAGAATATCGAAAGCAGATACTCTCGCTGCTTTCATCTCTTTCAACTAGT
TGCGCCGTGACCAATCTCGTTGCTTCCAACCTTTTGCAGGAACAACCAGTCGTTAATCAACCCTGGGAATGGATT
GAAAACTTGGATGAAGCATCCACGCTCGATGGATCCAGTAAAGATGAAGATCTTGATCGTCAGGAAAAGGCTCGG
CTCAAAACGCGGTACCTGGTGAAAAACTCAGGTTCCTTGTCTCTGGAAAATTTTCGTGCACAGATGACAGGGGAC
GGTGTTGTTGAACTTCTTGCAACAGACTACGATGCTCAAGCGCTGAATGATATACGGACTTTCGAGGATGGTCTA
GCCGCCGAGGGTATTTTTGCTCGTGATTGGAGGGAAAGTAGGATTGATGTTGATGAGTCGATATCGTCTCCTACC
TCGGTTTCAAGCGGACGCGCTATGCAGAGCCAAAGTGCTGGAGGTGGAGCTGGTAGTGGTGATGGAGATCAAGAA
TCTGGATCGTCCTCCAGTCATGCGAAGACTGAGAGGAAATTGACTCCTATGCGAGCGTCTCCAGCTTCTTCAATT
GTATCGCGAAGTTCCGCGAAGGGATCCACATCGTCATGGAAGCAACAGAGCCCGACTATGAGATTGGTCGGCGAA
GGTAATGATGCGGAGGGCCCTTCACGAGGTGTGGCCAAACGAAAAATGGATGATGGCGATGATGAAGTTGAGGCT
ATCGAACGTCCTGTTCCTAGTCATACCGCTCCACCCACCAAGCGCGCTAGAGCAGGCGCAGGAAAGACAACCGGG
AAGACCGCCGGAAAACCAAGGGCAAAGAAACGGTAA
Gene >AgabiH97|043840
ATGCCTGGACGCAAAGATGAAAACAACCTTCCACTGTATGAATCTCAACCCCCATCATGGCTCCCCAAATCGCAT
GCCACAGCTGACCTCGGTACAATCTCCCCGTTTTAAGCATATGTTACTTTTACTGAGGTGTGCTCTCATGAACAT
ATTCCCTTAGGTTACCCTGGGTTCTTCCCGACAAAGCCCGGCCAGGACGAGGATGTGCTATCTGATTCCAGAGTC
AGGTCTGGCTTCGTCCTAGGGCATCAAGTGTCAGTGAGTACCTGCACCGTATGTGTGTTACTCCTCCGACTGAAG
TTGAGAAATTTAGGCGGAAACCTTCAGCGCTCAGGCAATTATAAACGAAAACTTGAATGCCGGGGACACGTTGAA
TCAGTTGGAAAGTTTAATTAACGAAGTCTTTAAGCGTCGTGCCGACCGGATACCCCCCATCCCGTAAGTAATCGG
GCGGAAATTGGACATTAGGTCTTATAAGTCTTTCAGCTCTTCGACCTTTCGCCTGCCTACGAGGGTGACTCTCAA
TGAAGCGAGAAAACAAACATGGTTTGCCGACCTCGCAAATCCCGACGTCCCATTGCACAGGCTCAGGAAAAATGT
ACCCCATCTAGCGAAAGGTCATGATATGCTGGATTTGTTGCACCAGAACAATGTCGCCATACCCAGAGCGATTTG
GTTTCTTCGCGTATCTGGTGCCAATGAGACTGTGCATTCCTCCCACTTGTTTTCGTGATTGTAGGAATGGCTCAC
CTTACTTTGTAGACTGGATTGCGAGGCGGAAAAGGAAAGGGTTCCTATAATCCAACACAGTACAGCATTGATTGG
GCAAACGTCATGACTGGATATATGAAAAAACAGCTCGCCGATATTGCATTGCCAAGTGCTCCACGCCCTGGACTC
AACATCAAACAAACCTTCAAGGGTGTTCTCGCTGATGCCGAAGGAAGAGAGAAGTGGATCTCACGCTTTTCCTAC
TGGTATGTGTTTCTGTGGCCGCTAAGGAATACTCAGAATGACTCAGTTATATCAGTCTGATGCTCTTGCGAACGT
TTTACGCTGAAGGCCTTGTAGATCACAGGACGTTCCTTGTGTGGTTTGTGCATCAAATGGGTGTTTGCAATCTTG
CACAGGCTGGATTTTTGAGCCGTCTGGCGGATGAATATTTGAATCCAATTTTGATCAGTCGTGCTCTTGCTAGAC
CATTTGTGGACGCATGTCTCAATAAATTAGCTGAGGTAAATTCACCCGAACTACGCATCAAATTGGATCACCACC
ATGTTTCGCAGATCCGCAACACAGCACAAGAGTACCTGGCTGACACGGAGAAGCAGTTTTGCGTGATACTTCAAG
TATGCCTGCTCTGCCTCACGCCTACCGATCTGACCAATGCTTTCTAGCGTATCTGTCTGGCACTTCCAGATGCGT
TCGTTTGTCCTCGTATGTGGCTGGCGCATTCTGCAATGATCGCCGATGTCATGGCCGCCGACATCATCCAGTTTC
CTCCTGGCATTGAATGTTCTACAGATCGTGCCGTTCGAGAAATCCGACGTTCTATAAGCGATAATCTTTTCGACA
TAAAAAAACGAAACGAGGCTATCCTGTTTTTGGATCCCCCTTCGAAAGGGGTCGGACGCCTGTACATGACAATCA
TGGACGTGAAGGTATATTTACATTGGTTGTTTACAACCTCTGATTGACTCGGGCATTATAGCTGCTTAACTCTAT
TTCTGCGATGACAGACATGACAACAGTAAGCTTTTTCCAGAATGAGCTGGACAATACACCAGCTTTTCAAGAAAA
ACTGGATATGCTCCTCACCTGGAGTGTCACTACTTTGCAATATGGTGACCACCGCCCCTTTGCTGCTGTCACGCT
CATTCGTCTGTGGAGAGATAGGGCCTGCGAACGTGCAACTCGTCGTGGTACCGAGACTCCCAGTGATTTTTTGCA
AGATCAGCTATTTGATTGGTTAGACATATCAGAAGTCGCTGAAGAGGCAAAACATCTGCGGAGTATTGCTCTTCT
TTATGGAGAATTGATCAAAGAAGAACTGTTTTCCTATTCGAAGTACATACAGAGGTTGATCGCGCGAGGGGAACC
TGGATTATCCTTTACCGAAGTAAGCCTTCTGAGCACCGTTTATACTATCATCTCATTATTTATTATAGACGGCGA
TATCCAGGCATCGCCAATTTTTGCGCTGGATTCCCCTGCACAAATCTGTTTCCCCGGAAGTGAACCAGAGGAAGG
TCACCCTCTATGATTTAAAGGCTAGAAGTACCCCTGAAGATACCGCAGAACGGGAGATCCGTCAAGAGATCCGTC
TAATCCTTCCTGAACTTTTTGGCGGTTAGTTTTTTGTTTAGTTATCCCTTTAAAGCTATCAACAGAGGGCGAATT
ACTAGGAGAAACTGACTTCGATGTCACCACTTCTGTTACGTTATTGGACCAAAGCAAGATACTTATGAATGCTCC
TCGGTTTGAACAAGCGCGCAGTATACGGGACTGGTTTCTCCCAAAGCTACGAGAACTAGCATGCAGGTAAAATCA
CGTTCCTAACGATGCCCAGTATGCCGACCGCCTTCTAGACCTCATTCTGCCGTTACGGGCTCCTCTCTTTTGCGT
ATCTATTGTATATCTGTGGAAGTAATGTCCTATGTGAAATGCTTTGATTCTCTCCTCGATGTAGGTTACTTCACA
TATCGAATCAAAAGTGTCTGGCTGACCAAATGTCAGTTTACGCTCTGGGTCCTTGCGAACACAAAATATCCGGAG
TTGCTAGTTGCTATTATTGATACCCTCCATCGTTTTGCGACCATATGGTCATGTATGAATATCAAGCGAGATATT
GTCCTCGCCCTCGATTCGGCTCATCAAGCCTCGAAAAGTAGGGGTATACAATCAAGGGGTTTACTTTCACTACTT
GTTGAATTCGACCGAGATAAATCATATCTCAGCCCGGCGTCGCGGGAGCGCATTGACTCTGATCTGTGTCATTTT
ACACTGGTACGAGCGCCTTATCCGTCATCATGACATCTCTGACAACAGCAAAGGCTTTGAGACCAGTTACCGAAC
ACCCTGAGTCTGTGCCAGATCGCCTTACTGAAATCCTCTTGATGGCGGCCGATACGGCAGCAGATGCACCTTCAC
TACTTGCCAATGGTCTTTGGATCAAATATCGCACTTCTCTCGACTGGGCCTGGAAGGTGTGGGACAATACAATCG
CGAGTTTGCGTCAGGTTCCGTTGATGAACTCTGATACCACTCAGCGGAAGGCCTGTGCTCTGCGGTATGGTATGT
TCCTTTGGCAAGTCAATCAGCACCTCCCCGACGGTTTAGATGGTGACGTCCAGAGATGGTTCGCGGGTCCCGGCC
AAAACGAAATAGCTGCCTTGACTGCCGAGGCTTGGCAGGTCGTCACAGTATCATTATTGTATCTGTGTATTCACG
GAGCGCTGAAGTCCACAACTATCTTGACGGGTGTAGTTTATCCTGCGTGGCAACTCGGAGCTACAGAGTCGACCC
CAGAAGTTCATGTTTTCCTCACCTCCGCCAACAACCTCTTCCGACAACTATTGTTGCAAGAAACTCCTAACACTA
CAGGGATACCTCCGGTCGACCTCTTTGACGTTCAGTGCCTCCAGACTAGGCGGCGGACAGTCTATGAGGAACCAC
ATTTCTCATGCCTCGTCAAAAGCATTCCTCTCCTAATCCTCCTAGAGAACAAACTCGACATCCCACAGGAGATCA
GGGCTGAATTTACCTCACTTCGACACCAGCTGTGTCACGGTAACCAATTTCGTCAGGGAGCGTACAGGAGCTTAG
ATGTAATTCGAGCAGCTTTCGAAGACTATCCCCCCCTACCTGAACAGTCTTCAGCCAATTTGGGCCAAAACATCA
TAGCCGGTCTTAGGACTATCCTTGGAGACAATGTTGATGGTGAGTGTCACCTCTTTGACAGGCCGCTTGTCACTG
AACAATGCTGGCAAAAGAAAAAAATATGTATCATTGGCCCGAAGTAACCTGTCTACTTAGCCCTTGGAAAATCGT
CGCCACGACTATTCAGATGCAATTCTCAGTCAAACAGCTAGGGAAGGCGCTTACACAGGAAGCCACGCATGAGGC
AGCAAGTAGCAATCTAAACAAATTGTCAATCATGCTTTTTCATCAATCGATGACTTCGGAAGAGGCTTACTATGT
TGGGGAGATGGCACAAGGGGCTGATAGCACCGTCGCCAGCAAAGTCAGTTGATTCTGTCCTGCTTCACTTCGAGA
ACGTGACTGATGGGAACCACGGAAACTATTTGCCGCAATACAGTTCATAGCGAATGGTTTCAAATGCATCAATGA
GCTGCTTCAGGAATTCATATCCGAACAGATGACCAAAGCACTTGACAAGCTCCGACGCGTTGGGGAGGTGCTGCA
CGCGCTGGTTTATATCGCTCAGCCTTTTAGAAAGGAAGGAGCTCTGGTCCTGTATCTCGATCCTGTGGTCCAAGA
TGATTTCGTGGCAATCCTTCACAATAAACTTTCTGAAATTATAACCACCCTGGAGCCGAGCGCGTCTGCCCAAAT
CGATCAATCAGCACAAATCTCACAGCAGATTATCTTACTAGTTCGACTGTTACAGTTCGACCTTGGTTTCCGCGG
GGCATGGACCCCGAAAATGAAGGACCTTAGTGGCGGGTTCATCAGAAATCTCTTCCATCTTGCTCTGGTACGTCT
ATATTCTACCTGTCTTGGTCTGTTTCTGATGTATAGCCCTCGTTCATTCACCAATTTTATAGTATTTTGGTGCCC
CAGACCACCTCAATCCTGTCGTTTATCCACTCCTCGTTGATACATTGTTATTTATCATTGATGGTATGTAAGCTT
TTTACTTCAGGCCCAAGAGTGTTTCAAATGCTACAAATTCTAACATTACGTCAGAAATTCCACAGCCCGCAAAAC
CGCTTTCCTTCGATCCTTTCCGACACTACCCAAACACATTGACTTCTGATATCCCGACCGATCTCCCGTTAGAAT
ATCGAAAGCAGATACTCTCGCTGCTTTCATCTCTTTCAACTAGTTGCGCCGTGACCAATCTCGTTGCTTCCAACC
TTTTGCAGGAACAACCAGTCGTTAATCAACCCTGGGAATGGATTGAAAACTTGGATGAAGCATCCACGCTCGATG
GATCCAGTAAAGATGAAGATCTTGATCGTCAGGAAAAGGCTCGGCTCAAAACGCGGTACCTGGTGAAAAACTCAG
GTTCCTTGTCTCTGGAAAATTTTCGTGCACAGATGACAGGGGACGGTGTTGTTGAACTTCTTGCAACAGACTACG
ATGCTCAAGCGCTGAATGATATACGGACTTTCGAGGATGGTCTAGCCGCCGAGGGTATTTTTGCTCGTGATTGGA
GGGAAAGTAGGATTGATGTTGATGAGTCGATATCGTCTCCTACCTCGGTTTCAAGCGGACGCGCTATGCAGAGCC
AAAGTGCTGGAGGTGGAGCTGGTAGTGGTGATGGAGATCAAGAATCTGGATCGTCCTCCAGTCATGCGAAGACTG
AGAGGAAATTGACTCCTATGCGAGCGTCTCCAGCTTCTTCAATTGTATCGCGAAGTTCCGCGAAGGGATCCACAT
CGTCATGGAAGCAACAGAGCCCGACTATGAGATTGGTCGGCGAAGGTAATGATGCGGAGGGCCCTTCACGAGGTG
TGGCCAAACGAAAAATGGATGATGGCGATGATGAAGTTGAGGCTATCGAACGTCCTGTTCCTAGTCATACCGCTC
CACCCACCAAGCGCGCTAGAGCAGGCGCAGGAAAGACAACCGGGAAGACCGCCGGAAAACCAAGGGCAAAGAAAC
GGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail