Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043470
Gene name
Locationscaffold_2:1258081..1259057
Strand-
Gene length (bp)976
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07106 TBPIP TBPIP/Hop2 winged helix domain 1.1E-16 18 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGK2|HOP2_SCHPO Homologous-pairing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu13 PE=1 SV=1 8 211 2.0E-27
sp|Q9FX64|HOP2_ARATH Homologous-pairing protein 2 homolog OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 23 220 3.0E-22
sp|Q91ZY6|HOP2_RAT Homologous-pairing protein 2 homolog OS=Rattus norvegicus GN=Psmc3ip PE=1 SV=1 23 220 8.0E-19
sp|O35047|HOP2_MOUSE Homologous-pairing protein 2 homolog OS=Mus musculus GN=Psmc3ip PE=1 SV=1 23 220 4.0E-18
sp|Q9P2W1|HOP2_HUMAN Homologous-pairing protein 2 homolog OS=Homo sapiens GN=PSMC3IP PE=1 SV=1 23 220 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGK2|HOP2_SCHPO Homologous-pairing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu13 PE=1 SV=1 8 211 2.0E-27
sp|Q9FX64|HOP2_ARATH Homologous-pairing protein 2 homolog OS=Arabidopsis thaliana GN=HOP2 PE=1 SV=1 23 220 3.0E-22
sp|Q91ZY6|HOP2_RAT Homologous-pairing protein 2 homolog OS=Rattus norvegicus GN=Psmc3ip PE=1 SV=1 23 220 8.0E-19
sp|O35047|HOP2_MOUSE Homologous-pairing protein 2 homolog OS=Mus musculus GN=Psmc3ip PE=1 SV=1 23 220 4.0E-18
sp|Q9P2W1|HOP2_HUMAN Homologous-pairing protein 2 homolog OS=Homo sapiens GN=PSMC3IP PE=1 SV=1 23 220 2.0E-17
sp|P53187|HOP2_YEAST Homologous-pairing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOP2 PE=1 SV=4 1 211 3.0E-10
sp|Q63ZL2|HOP2_XENLA Homologous-pairing protein 2 homolog OS=Xenopus laevis GN=psmc3ip PE=2 SV=1 23 213 1.0E-08
sp|Q54UM1|HOP2_DICDI Homologous-pairing protein 2 homolog OS=Dictyostelium discoideum GN=hop2 PE=3 SV=1 13 221 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043470
MSSKTKSETKVAVLKGQEAEDKVLEYMKLMNRPFGAVDVAANLKGAVPKATTQKILLALAEKGELTLKTYGKTTF
FVVNQSKLDCLPAEEIAMLESDLKVVEEQNKALGVELKNASAELMKHKSCPTDAEIEVQIAQLTKKIEQARERLR
PLQQGAVTISSEDVAHVEKEWMLWRGEWVRRRKVFTEFWQLATDVLSPQDAKELGEDLGVEWDSVEHVALERGLA
KTALKRKRA*
Coding >AgabiH97|043470
ATGTCTTCAAAAACAAAGTCAGAAACAAAAGTTGCCGTTCTCAAAGGCCAGGAAGCCGAGGATAAGGTCCTCGAG
TACATGAAACTCATGAACCGTCCGTTCGGAGCGGTGGATGTCGCTGCTAACCTTAAGGGTGCCGTGCCCAAGGCG
ACTACACAGAAAATCCTCTTGGCTCTTGCAGAAAAGGGCGAGTTGACTCTGAAAACTTATGGCAAAACTACGTTC
TTCGTGGTCAATCAGTCCAAACTAGATTGCCTCCCCGCAGAAGAAATTGCGATGCTAGAAAGTGATCTGAAGGTC
GTCGAAGAGCAGAACAAGGCATTAGGAGTCGAGCTGAAAAATGCATCAGCTGAACTTATGAAGCATAAATCGTGC
CCTACGGACGCGGAAATCGAAGTTCAAATCGCTCAATTGACCAAGAAGATTGAGCAAGCTAGGGAACGTCTGAGA
CCGTTGCAACAAGGAGCAGTGACTATTTCGAGCGAGGACGTTGCGCATGTGGAAAAGGAATGGATGCTTTGGCGA
GGAGAGTGGGTTCGGCGGCGAAAAGTATTCACAGAATTCTGGCAGCTGGCAACGGACGTGCTTTCGCCGCAGGAC
GCAAAGGAGCTCGGGGAGGATCTGGGAGTGGAGTGGGACAGTGTTGAGCATGTGGCCCTTGAGCGAGGCCTGGCA
AAGACGGCGCTGAAGAGGAAGCGAGCTTGA
Transcript >AgabiH97|043470
ATGTCTTCAAAAACAAAGTCAGAAACAAAAGTTGCCGTTCTCAAAGGCCAGGAAGCCGAGGATAAGGTCCTCGAG
TACATGAAACTCATGAACCGTCCGTTCGGAGCGGTGGATGTCGCTGCTAACCTTAAGGGTGCCGTGCCCAAGGCG
ACTACACAGAAAATCCTCTTGGCTCTTGCAGAAAAGGGCGAGTTGACTCTGAAAACTTATGGCAAAACTACGTTC
TTCGTGGTCAATCAGTCCAAACTAGATTGCCTCCCCGCAGAAGAAATTGCGATGCTAGAAAGTGATCTGAAGGTC
GTCGAAGAGCAGAACAAGGCATTAGGAGTCGAGCTGAAAAATGCATCAGCTGAACTTATGAAGCATAAATCGTGC
CCTACGGACGCGGAAATCGAAGTTCAAATCGCTCAATTGACCAAGAAGATTGAGCAAGCTAGGGAACGTCTGAGA
CCGTTGCAACAAGGAGCAGTGACTATTTCGAGCGAGGACGTTGCGCATGTGGAAAAGGAATGGATGCTTTGGCGA
GGAGAGTGGGTTCGGCGGCGAAAAGTATTCACAGAATTCTGGCAGCTGGCAACGGACGTGCTTTCGCCGCAGGAC
GCAAAGGAGCTCGGGGAGGATCTGGGAGTGGAGTGGGACAGTGTTGAGCATGTGGCCCTTGAGCGAGGCCTGGCA
AAGACGGCGCTGAAGAGGAAGCGAGCTTGA
Gene >AgabiH97|043470
ATGTCTTCAAAAACAAAGTCAGAAACAAAAGTTGCCGTTCTCAAAGGCCAGGAAGCCGAGGATAAGGTCCTCGAG
TACATGAAACTCGTGATCTCCCACGCGTCTCCCTGTCTTCCAACTGGCTGACGACGCATATACTCAGATGAACCG
TCCGTTCGGAGCGGTGGATGTCGCTGCTAACCTTAAGGGTGCCGTGCCCAAGGCGACTACACAGAAAATCCTCTT
GGCTCTTGCAGAAAAGGGCGAGTTGACTCTGAAAACTTATGGTATATCCCCTGAGGATGGAATGTACGCGGCTTC
CTTTTGACGGGCACACAGGCAAAACTACGTTCTTCGTGGTCAATCAGTCCAAACTAGATTGCCTCCCCGCAGAAG
AAATTGCGATGCTAGAAAGTGATCTGAAGGTCGTCGAAGAGCAGAACAAGGCATTAGGAGTCGAGCTGAAAAATG
CATCAGCTGGTAGAAGATCAGCTGGAGCTTCTTTATGCGCTCGATCGCTGACGCTGAAACCAACCAGAACTTATG
AAGCATAAATCGTGCCCTACGGACGCGGAAATCGAAGTTCAAATCGCTCAATTGACCAAGAAGGTATTTGCAGAT
TGCGCGTCACATCAGTGCTACTACCCAGACACATAACATCATAGATTGAGCAAGCTAGGGAACGTCTGAGACCGT
TGCAACAAGGAGCAGTGACTATTTCGAGCGAGGACGTTGCGCATGTGGAAAAGGAATGGATGCTTTGGCGAGGAG
AGTGGGTTCGGCGGCGAAAAGTATTCACAGAGTACGAGTGACAGCAGAAAATGCGCAGTCAAGAAGCTGACGGTG
TTACAGATTCTGGCAGCTGGCAACGGACGTGCTTTCGCCGCAGGACGCAAAGGAGCTCGGGGAGGATCTGGGAGT
GGAGTGGGACAGTGTTGAGCATGTGGCCCTTGAGCGAGGCCTGGCAAAGACGGCGCTGAAGAGGAAGCGAGCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail