Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043460
Gene name
Locationscaffold_2:1256914..1257949
Strand-
Gene length (bp)1035
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 5.2E-48 10 180
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.1E-23 10 124
PF00025 Arf ADP-ribosylation factor family 6.7E-05 10 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 1 187 1.0E-76
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 7 185 6.0E-67
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 7 183 6.0E-67
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 3 187 3.0E-65
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 7 183 5.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 1 187 1.0E-76
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 7 185 6.0E-67
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 7 183 6.0E-67
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 3 187 3.0E-65
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 7 183 5.0E-65
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 5 183 2.0E-64
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 7 187 7.0E-64
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 7 182 3.0E-63
sp|P06781|RHO2_YEAST GTP-binding protein RHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO2 PE=1 SV=2 7 186 6.0E-62
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 7 186 6.0E-60
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 7 191 1.0E-59
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 7 187 1.0E-58
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 7 187 1.0E-58
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 7 187 1.0E-58
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 7 187 1.0E-58
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 7 187 1.0E-58
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 7 182 6.0E-58
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 7 187 7.0E-58
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 7 182 8.0E-58
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 7 182 1.0E-57
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 7 187 3.0E-57
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 7 186 4.0E-57
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 7 186 5.0E-57
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 7 187 9.0E-57
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 7 187 9.0E-57
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 7 187 9.0E-57
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 7 187 9.0E-57
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 7 187 6.0E-56
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 7 187 6.0E-56
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 7 187 6.0E-56
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 7 187 6.0E-56
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 7 192 5.0E-55
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 4 182 8.0E-51
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 10 182 2.0E-50
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 10 182 2.0E-50
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 10 182 2.0E-50
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 10 182 2.0E-50
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 10 182 2.0E-50
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 10 182 2.0E-50
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 10 182 4.0E-50
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 6 174 8.0E-50
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 5 182 1.0E-49
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 10 193 1.0E-49
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 6 182 3.0E-49
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 10 182 4.0E-49
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 10 182 4.0E-49
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 10 182 4.0E-49
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 10 182 5.0E-49
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 10 182 2.0E-48
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 9 177 3.0E-48
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 10 180 2.0E-47
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 10 186 4.0E-47
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 10 193 6.0E-47
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 10 185 3.0E-46
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 10 182 8.0E-46
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 10 182 1.0E-45
sp|Q96WY0|RHOC_EMENI GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 9 186 1.0E-45
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 10 206 1.0E-45
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 10 182 1.0E-45
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 10 185 2.0E-45
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 10 182 2.0E-45
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 10 183 3.0E-45
sp|O96390|RACF1_DICDI Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 10 180 3.0E-45
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 10 180 3.0E-45
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 10 180 4.0E-45
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 10 182 4.0E-45
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 10 202 5.0E-45
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 10 180 7.0E-45
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 10 182 7.0E-45
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 10 182 9.0E-45
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 10 182 1.0E-44
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 10 182 1.0E-44
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 10 182 1.0E-44
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 10 182 1.0E-44
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 10 182 2.0E-44
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 10 182 2.0E-44
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 10 182 2.0E-44
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 10 182 2.0E-44
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 10 182 2.0E-44
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 10 182 2.0E-44
sp|Q9GPS3|RACF2_DICDI Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 10 180 2.0E-44
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 10 201 3.0E-44
sp|Q05062|CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 10 182 4.0E-44
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 10 182 5.0E-44
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 10 182 5.0E-44
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 10 182 5.0E-44
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 10 182 5.0E-44
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 10 182 6.0E-44
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 10 182 6.0E-44
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 10 182 7.0E-44
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 10 182 7.0E-44
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 10 182 7.0E-44
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 10 182 1.0E-43
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 10 182 2.0E-43
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 10 182 2.0E-43
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 10 206 3.0E-43
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 10 182 3.0E-43
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 10 204 4.0E-43
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 10 208 4.0E-43
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 10 180 5.0E-43
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 10 182 5.0E-43
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 10 182 5.0E-43
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 10 182 7.0E-43
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 10 183 8.0E-43
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 10 215 9.0E-43
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 10 182 9.0E-43
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 10 182 9.0E-43
sp|Q5R9F4|RND3_PONAB Rho-related GTP-binding protein RhoE OS=Pongo abelii GN=RND3 PE=2 SV=1 7 180 1.0E-42
sp|Q6SA80|RND3_RAT Rho-related GTP-binding protein RhoE OS=Rattus norvegicus GN=Rnd3 PE=2 SV=1 7 180 1.0E-42
sp|P61588|RND3_MOUSE Rho-related GTP-binding protein RhoE OS=Mus musculus GN=Rnd3 PE=1 SV=1 7 180 1.0E-42
sp|P61587|RND3_HUMAN Rho-related GTP-binding protein RhoE OS=Homo sapiens GN=RND3 PE=1 SV=1 7 180 1.0E-42
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 10 182 1.0E-42
sp|O77683|RND3_PIG Rho-related GTP-binding protein RhoE OS=Sus scrofa GN=RND3 PE=2 SV=1 7 180 4.0E-42
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 6 185 4.0E-42
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 15 177 6.0E-42
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 10 182 9.0E-42
sp|Q9GPQ8|RACL_DICDI Rho-related protein racL OS=Dictyostelium discoideum GN=racL PE=3 SV=1 10 180 1.0E-41
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 10 180 2.0E-41
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 10 182 2.0E-41
sp|Q9JJL4|RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 4 182 3.0E-41
sp|Q8R527|RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 4 182 3.0E-41
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 10 198 4.0E-41
sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 4 182 4.0E-41
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 10 182 7.0E-41
sp|Q9H4E5|RHOJ_HUMAN Rho-related GTP-binding protein RhoJ OS=Homo sapiens GN=RHOJ PE=1 SV=1 10 177 2.0E-40
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 10 180 2.0E-40
sp|Q9ER71|RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2 10 177 4.0E-40
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 10 179 1.0E-39
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 10 222 2.0E-39
sp|Q23862|RACE_DICDI Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 8 177 2.0E-39
sp|Q24817|RACD_ENTHI Rho-related protein racD (Fragment) OS=Entamoeba histolytica GN=RACD PE=2 SV=1 10 177 3.0E-39
sp|Q9EQT3|RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 10 221 5.0E-39
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 10 222 1.0E-38
sp|Q54YY4|RACN_DICDI Rho-related protein racN OS=Dictyostelium discoideum GN=racN PE=3 SV=1 10 208 2.0E-38
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 10 177 3.0E-38
sp|Q9P8V0|RHO4_ASHGO GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 8 182 4.0E-38
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 10 199 1.0E-37
sp|O94103|CDC42_COLGL Cell division control protein 42 homolog OS=Colletotrichum gloeosporioides GN=CDC42 PE=3 SV=1 10 182 1.0E-37
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 10 180 3.0E-37
sp|P31021|RHO1_ENTHI Ras-like GTP-binding protein RHO1 OS=Entamoeba histolytica GN=RHO1 PE=3 SV=1 10 198 6.0E-37
sp|P53879|RHO5_YEAST GTP-binding protein RHO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO5 PE=1 SV=2 10 215 9.0E-37
sp|P52198|RND2_HUMAN Rho-related GTP-binding protein RhoN OS=Homo sapiens GN=RND2 PE=1 SV=2 8 182 4.0E-36
sp|Q9QYM5|RND2_MOUSE Rho-related GTP-binding protein RhoN OS=Mus musculus GN=Rnd2 PE=2 SV=1 8 182 4.0E-36
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 10 201 4.0E-35
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 10 182 4.0E-34
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 10 182 7.0E-34
sp|Q8VDU1|RHOV_MOUSE Rho-related GTP-binding protein RhoV OS=Mus musculus GN=Rhov PE=2 SV=1 10 182 2.0E-33
sp|Q96L33|RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens GN=RHOV PE=1 SV=1 10 182 2.0E-33
sp|Q9Z1Y0|RHOV_RAT Rho-related GTP-binding protein RhoV OS=Rattus norvegicus GN=Rhov PE=1 SV=1 10 182 2.0E-33
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 10 182 3.0E-33
sp|P34150|RACD_DICDI Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3 22 172 3.0E-33
sp|Q17QI8|RHOV_BOVIN Rho-related GTP-binding protein RhoV OS=Bos taurus GN=Rhov PE=2 SV=1 10 182 8.0E-33
sp|Q54HZ7|RACM_DICDI Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 10 181 1.0E-32
sp|Q92730|RND1_HUMAN Rho-related GTP-binding protein Rho6 OS=Homo sapiens GN=RND1 PE=1 SV=1 8 203 8.0E-32
sp|Q8BLR7|RND1_MOUSE Rho-related GTP-binding protein Rho6 OS=Mus musculus GN=Rnd1 PE=2 SV=1 7 189 1.0E-31
sp|Q2HJ68|RND1_BOVIN Rho-related GTP-binding protein Rho6 OS=Bos taurus GN=RND1 PE=2 SV=1 8 178 9.0E-31
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 3 125 1.0E-21
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 3 125 1.0E-21
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 3 125 1.0E-21
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 3 125 1.0E-21
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 3 191 2.0E-21
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 8 125 3.0E-21
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 3 125 7.0E-21
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 3 125 7.0E-21
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 3 125 7.0E-21
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 3 125 1.0E-20
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 7 174 1.0E-20
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 1 125 1.0E-20
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 3 164 1.0E-20
sp|Q9DAK3|RHBT1_MOUSE Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2 10 185 2.0E-20
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 10 164 2.0E-20
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 10 174 3.0E-20
sp|Q91V93|RHBT2_MOUSE Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2 10 185 4.0E-20
sp|Q9BYZ6|RHBT2_HUMAN Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2 10 185 4.0E-20
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 10 179 5.0E-20
sp|O94844|RHBT1_HUMAN Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=2 SV=2 10 185 6.0E-20
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 10 154 8.0E-20
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 1 125 8.0E-20
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 1 125 3.0E-19
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 8 125 4.0E-19
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 4 193 4.0E-19
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 10 207 6.0E-19
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 10 207 7.0E-19
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 10 200 8.0E-19
sp|Q54Z85|RACO_DICDI Rho-related protein racO OS=Dictyostelium discoideum GN=racO PE=3 SV=1 10 176 8.0E-19
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 10 174 8.0E-19
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 10 174 1.0E-18
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 10 174 1.0E-18
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 7 198 1.0E-18
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 10 174 1.0E-18
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 10 174 2.0E-18
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 8 164 2.0E-18
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 4 174 4.0E-18
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 10 207 5.0E-18
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 4 125 5.0E-18
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 10 205 6.0E-18
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 1 201 6.0E-18
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 10 220 8.0E-18
sp|P48555|RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 6 174 8.0E-18
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 10 203 1.0E-17
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 10 207 1.0E-17
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 10 182 1.0E-17
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 10 175 2.0E-17
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 10 187 2.0E-17
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 10 201 2.0E-17
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 1 201 2.0E-17
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 1 201 2.0E-17
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 10 125 2.0E-17
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 10 126 2.0E-17
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 10 125 2.0E-17
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 10 125 2.0E-17
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 10 125 2.0E-17
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 10 220 3.0E-17
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 10 179 3.0E-17
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 10 125 3.0E-17
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 1 125 3.0E-17
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 1 184 5.0E-17
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 10 125 5.0E-17
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 10 126 6.0E-17
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 10 182 6.0E-17
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 10 125 6.0E-17
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 10 125 6.0E-17
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 10 125 6.0E-17
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 10 126 6.0E-17
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 10 125 6.0E-17
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 10 125 7.0E-17
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 10 174 7.0E-17
sp|Q54FK5|RABN1_DICDI Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 1 182 7.0E-17
sp|P70426|RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 10 179 8.0E-17
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 10 220 8.0E-17
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 10 190 1.0E-16
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 10 220 1.0E-16
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 10 182 1.0E-16
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 7 175 1.0E-16
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 10 195 1.0E-16
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 10 195 1.0E-16
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 10 206 1.0E-16
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 10 125 1.0E-16
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 10 134 2.0E-16
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 10 195 2.0E-16
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 10 195 2.0E-16
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 10 195 2.0E-16
sp|P23175|RASH_MSVNS GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 10 220 2.0E-16
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 10 125 2.0E-16
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 10 125 2.0E-16
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 10 125 2.0E-16
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 10 125 2.0E-16
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 10 125 2.0E-16
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 10 175 2.0E-16
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 10 134 2.0E-16
sp|Q559X6|RAB2B_DICDI Ras-related protein Rab-2B OS=Dictyostelium discoideum GN=rab2B PE=3 SV=1 10 189 2.0E-16
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 10 125 2.0E-16
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 10 134 2.0E-16
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 10 134 2.0E-16
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 7 125 2.0E-16
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 10 201 2.0E-16
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 10 134 2.0E-16
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 1 222 2.0E-16
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 10 125 3.0E-16
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 10 125 3.0E-16
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 10 125 3.0E-16
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 10 215 3.0E-16
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 10 174 3.0E-16
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 10 125 3.0E-16
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 10 125 3.0E-16
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 10 175 3.0E-16
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 10 220 3.0E-16
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 10 134 3.0E-16
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 10 125 3.0E-16
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 10 193 3.0E-16
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 10 174 3.0E-16
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 10 126 3.0E-16
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 2 182 3.0E-16
sp|P25378|RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2 4 174 3.0E-16
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 10 125 3.0E-16
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 10 125 4.0E-16
sp|Q9H0N0|RAB6C_HUMAN Ras-related protein Rab-6C OS=Homo sapiens GN=RAB6C PE=1 SV=2 3 125 4.0E-16
sp|P01113|RASH_MSVMO GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 10 220 4.0E-16
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 10 195 4.0E-16
sp|P34142|RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 10 204 4.0E-16
sp|P01114|RASH_RRASV Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 10 220 5.0E-16
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 10 174 5.0E-16
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 10 125 5.0E-16
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 10 125 5.0E-16
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 10 125 5.0E-16
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 6 206 6.0E-16
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 10 126 6.0E-16
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 10 125 6.0E-16
sp|Q6IP71|RALBB_XENLA Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 10 174 6.0E-16
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 7 175 7.0E-16
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 10 179 8.0E-16
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 10 126 8.0E-16
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 10 126 8.0E-16
sp|P01115|RASH_MSVHA Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 10 220 8.0E-16
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 10 174 9.0E-16
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 10 179 9.0E-16
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 10 174 9.0E-16
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 10 220 9.0E-16
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 10 132 9.0E-16
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 10 128 9.0E-16
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 10 126 1.0E-15
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 10 132 1.0E-15
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 10 179 1.0E-15
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 10 193 1.0E-15
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 10 132 1.0E-15
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 10 132 1.0E-15
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 10 132 1.0E-15
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 10 182 1.0E-15
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 10 134 1.0E-15
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 10 219 1.0E-15
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 10 188 1.0E-15
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 10 125 1.0E-15
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 10 179 1.0E-15
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 10 179 1.0E-15
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 10 188 1.0E-15
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 10 188 1.0E-15
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 10 188 1.0E-15
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 10 188 1.0E-15
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 10 187 1.0E-15
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 10 187 1.0E-15
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 10 188 1.0E-15
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 10 179 1.0E-15
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 10 179 1.0E-15
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 10 179 1.0E-15
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 10 187 2.0E-15
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 10 125 2.0E-15
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 10 179 2.0E-15
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 10 124 2.0E-15
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 10 124 2.0E-15
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 10 124 2.0E-15
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 10 174 2.0E-15
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 10 126 2.0E-15
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 7 125 2.0E-15
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 8 188 2.0E-15
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 10 126 2.0E-15
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 10 126 2.0E-15
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 10 174 2.0E-15
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 10 126 2.0E-15
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 10 126 2.0E-15
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 10 126 2.0E-15
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 10 126 2.0E-15
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 10 126 2.0E-15
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 10 126 2.0E-15
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 10 126 2.0E-15
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 10 126 2.0E-15
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 10 126 2.0E-15
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 10 126 2.0E-15
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 10 126 2.0E-15
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 10 126 2.0E-15
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 10 174 2.0E-15
sp|P49103|RAB2A_MAIZE Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 10 174 2.0E-15
sp|Q295X7|RAS1_DROPS Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 21 179 2.0E-15
sp|B4GFJ8|RAS1_DROPE Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 21 179 2.0E-15
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 10 179 2.0E-15
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 10 179 3.0E-15
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 10 126 3.0E-15
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 10 126 3.0E-15
sp|P70425|RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 10 179 3.0E-15
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 10 175 3.0E-15
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 10 220 3.0E-15
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 10 174 3.0E-15
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 6 179 3.0E-15
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 17 179 3.0E-15
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 10 192 4.0E-15
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 10 126 4.0E-15
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 10 220 4.0E-15
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 10 134 4.0E-15
sp|Q5BJQ5|RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 10 179 4.0E-15
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 10 174 4.0E-15
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 10 180 4.0E-15
sp|B4JFU8|RAS1_DROGR Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 21 179 4.0E-15
sp|Q7GD79|RAN2_ORYSJ GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1 10 126 4.0E-15
sp|A2Y7R5|RAN2_ORYSI GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1 10 126 4.0E-15
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 10 179 4.0E-15
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 4 125 4.0E-15
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 6 179 4.0E-15
sp|B4NJ72|RAS1_DROWI Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 21 179 4.0E-15
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 10 134 5.0E-15
sp|B4PUP5|RAS1_DROYA Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|P83831|RAS1_DROSI Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|B4HKC7|RAS1_DROSE Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|P08646|RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 21 179 5.0E-15
sp|P83832|RAS1_DROMA Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|B3NZR4|RAS1_DROER Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|B3M185|RAS1_DROAN Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 21 179 5.0E-15
sp|Q99578|RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 10 190 5.0E-15
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 10 174 5.0E-15
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 10 126 5.0E-15
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 10 179 5.0E-15
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 10 125 5.0E-15
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 10 174 6.0E-15
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 10 182 6.0E-15
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 10 126 6.0E-15
sp|Q5JT25|RAB41_HUMAN Ras-related protein Rab-41 OS=Homo sapiens GN=RAB41 PE=1 SV=2 3 189 6.0E-15
sp|Q7F7I7|RAN1_ORYSJ GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1 10 126 6.0E-15
sp|A2WSI7|RAN1_ORYSI GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2 10 126 6.0E-15
sp|B4LY29|RAS1_DROVI Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 21 179 6.0E-15
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 10 182 7.0E-15
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 10 125 7.0E-15
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 10 125 7.0E-15
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 10 125 7.0E-15
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 10 125 7.0E-15
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 4 189 7.0E-15
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 10 179 7.0E-15
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 10 179 8.0E-15
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 10 175 8.0E-15
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 10 179 8.0E-15
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 10 179 8.0E-15
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 10 179 8.0E-15
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 10 179 8.0E-15
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 10 179 8.0E-15
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 10 179 8.0E-15
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 10 179 8.0E-15
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 10 182 8.0E-15
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 10 126 8.0E-15
sp|P10301|RRAS_HUMAN Ras-related protein R-Ras OS=Homo sapiens GN=RRAS PE=1 SV=1 21 195 8.0E-15
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 4 189 8.0E-15
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 1 193 8.0E-15
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 10 179 8.0E-15
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 10 179 8.0E-15
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 10 125 9.0E-15
sp|P38545|RAN_PLAFA GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 10 126 9.0E-15
sp|Q8K586|RANT_RAT GTP-binding nuclear protein Ran, testis-specific isoform OS=Rattus norvegicus GN=Rasl2-9 PE=2 SV=1 7 126 1.0E-14
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 11 126 1.0E-14
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 10 187 1.0E-14
sp|P54766|RAN1B_LOTJA GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1 10 126 1.0E-14
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 10 125 1.0E-14
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 10 221 1.0E-14
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 10 174 1.0E-14
sp|P54765|RAN1A_LOTJA GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1 10 126 1.0E-14
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 10 126 1.0E-14
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 10 179 1.0E-14
sp|Q5PR73|DIRA2_MOUSE GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 10 203 1.0E-14
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 10 220 2.0E-14
sp|Q8H156|RAN3_ARATH GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2 10 126 2.0E-14
sp|P41918|RANA1_TOBAC GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1 10 126 2.0E-14
sp|P41919|RANB1_TOBAC GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1 10 126 2.0E-14
sp|P38547|RAN2_SOLLC GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1 10 126 2.0E-14
sp|P38546|RAN1_SOLLC GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1 10 126 2.0E-14
sp|P38548|RAN_VICFA GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1 10 126 2.0E-14
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 10 193 2.0E-14
sp|P41916|RAN1_ARATH GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 10 126 2.0E-14
sp|Q8TAI7|REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 9 127 2.0E-14
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 10 174 2.0E-14
sp|P59279|RAB2B_MOUSE Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 10 164 2.0E-14
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 10 220 2.0E-14
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 10 182 2.0E-14
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 10 175 2.0E-14
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 10 178 2.0E-14
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 10 125 3.0E-14
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 10 175 3.0E-14
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 10 192 3.0E-14
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 10 125 3.0E-14
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 10 125 3.0E-14
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 10 174 3.0E-14
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 10 125 3.0E-14
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 10 174 3.0E-14
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 10 189 3.0E-14
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 10 174 3.0E-14
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 1 201 3.0E-14
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 10 189 4.0E-14
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 2 180 4.0E-14
sp|Q9GPQ9|RACJ_DICDI Rho-related protein racJ OS=Dictyostelium discoideum GN=racJ PE=3 SV=1 4 182 4.0E-14
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 10 125 4.0E-14
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 10 179 4.0E-14
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 10 174 4.0E-14
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 10 125 4.0E-14
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 10 188 4.0E-14
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 10 167 5.0E-14
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 10 125 5.0E-14
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 10 153 5.0E-14
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 10 153 5.0E-14
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 10 153 5.0E-14
sp|Q7TNZ5|REBL1_RAT GTPase RhebL1 OS=Rattus norvegicus GN=Rhebl1 PE=2 SV=1 9 174 6.0E-14
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 10 126 6.0E-14
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 10 182 6.0E-14
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 10 175 6.0E-14
sp|Q61820|RANT_MOUSE GTP-binding nuclear protein Ran, testis-specific isoform OS=Mus musculus GN=Rasl2-9 PE=2 SV=1 7 126 7.0E-14
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 10 179 7.0E-14
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 10 179 7.0E-14
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 10 179 7.0E-14
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 10 179 7.0E-14
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 10 167 7.0E-14
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 10 196 7.0E-14
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 10 175 7.0E-14
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 10 174 8.0E-14
sp|Q95KD9|DIRA2_MACFA GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 10 203 8.0E-14
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 10 174 8.0E-14
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 3 124 8.0E-14
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 10 175 8.0E-14
sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 10 203 8.0E-14
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 10 125 8.0E-14
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 10 196 9.0E-14
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 10 189 9.0E-14
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 1 182 9.0E-14
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 2 179 1.0E-13
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 10 175 1.0E-13
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 10 132 1.0E-13
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 10 156 1.0E-13
sp|Q5R6S2|DIRA2_PONAB GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 10 203 1.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043460
MAFHNPIRRKLVIVGDGACGKTSLLCSFALGRFPKEYEPTVFDNYVAEIKLDEKPVQLALWDTAGQEEYERLRPM
SYAHSHVILIAFALDTPDSLENVTTKWIEEVRELCGASIPVILVGCKADLRPNTDHPNTPDNPCTWVTREMGERV
AQAIGARAYKECSALRIEGVDDVFEAATRASMLMREGVPSHPQAAEARQTRRRSVGKAASDETGDGWKCCIIC*
Coding >AgabiH97|043460
ATGGCCTTCCACAACCCAATCAGACGAAAGCTCGTCATCGTAGGCGACGGTGCTTGCGGAAAGACCTCCCTTCTC
TGCTCCTTTGCACTGGGCAGGTTTCCTAAAGAATATGAACCAACCGTCTTTGATAATTATGTGGCCGAGATAAAG
CTTGATGAAAAGCCTGTGCAGTTGGCTCTATGGGATACTGCTGGCCAGGAAGAATACGAACGACTGCGGCCCATG
TCATATGCCCATTCCCATGTCATCCTCATTGCCTTCGCTCTTGATACCCCTGACTCGTTAGAAAACGTCACAACA
AAGTGGATCGAGGAGGTCCGCGAGCTCTGTGGTGCCAGCATCCCCGTCATTCTAGTAGGCTGCAAAGCAGACCTT
CGGCCGAATACTGACCATCCGAACACACCGGACAACCCTTGTACTTGGGTGACACGGGAGATGGGTGAACGTGTC
GCTCAAGCTATCGGGGCTCGTGCATATAAAGAATGTTCAGCACTCAGAATCGAAGGTGTCGATGACGTCTTTGAA
GCCGCCACGAGGGCTAGCATGCTAATGCGAGAGGGTGTTCCCAGTCATCCTCAAGCTGCAGAGGCGAGACAGACC
CGAAGACGGAGTGTAGGGAAGGCCGCATCAGACGAGACTGGAGATGGATGGAAATGTTGTATTATCTGCTGA
Transcript >AgabiH97|043460
ATGGCCTTCCACAACCCAATCAGACGAAAGCTCGTCATCGTAGGCGACGGTGCTTGCGGAAAGACCTCCCTTCTC
TGCTCCTTTGCACTGGGCAGGTTTCCTAAAGAATATGAACCAACCGTCTTTGATAATTATGTGGCCGAGATAAAG
CTTGATGAAAAGCCTGTGCAGTTGGCTCTATGGGATACTGCTGGCCAGGAAGAATACGAACGACTGCGGCCCATG
TCATATGCCCATTCCCATGTCATCCTCATTGCCTTCGCTCTTGATACCCCTGACTCGTTAGAAAACGTCACAACA
AAGTGGATCGAGGAGGTCCGCGAGCTCTGTGGTGCCAGCATCCCCGTCATTCTAGTAGGCTGCAAAGCAGACCTT
CGGCCGAATACTGACCATCCGAACACACCGGACAACCCTTGTACTTGGGTGACACGGGAGATGGGTGAACGTGTC
GCTCAAGCTATCGGGGCTCGTGCATATAAAGAATGTTCAGCACTCAGAATCGAAGGTGTCGATGACGTCTTTGAA
GCCGCCACGAGGGCTAGCATGCTAATGCGAGAGGGTGTTCCCAGTCATCCTCAAGCTGCAGAGGCGAGACAGACC
CGAAGACGGAGTGTAGGGAAGGCCGCATCAGACGAGACTGGAGATGGATGGAAATGTTGTATTATCTGCTGA
Gene >AgabiH97|043460
ATGGCCTTCCACAACCCAGTCTGTCTCCTCTCTCCTCTCCTTATTCTCTGAGCTCATCCCCCAACAGATCAGACG
AAAGCTCGTCATCGTAGGCGACGGCAGGTGTCCTTCCCGCACCCCTTTACTTTCCTCTCATGTCTCTTGCAGGTG
CTTGCGGAAAGACCTCCCTTCTCTGCTCCTTTGCACTGGGCAGGTTTCCTAAAGAATATGTGCGTTTCCCCCCTT
TTTTTCTTCTTCGACCGGCGCTCATGTTCTTCCAGGAACCAAGTATGCAATACATCGTGTACCTCTTCCTAGATG
TGGCTCAACCCCCGTCCCAGCCGTCTTTGATAATTATGTGGCCGAGATAAAGCTTGATGAAAAGCCTGTGCAGTT
GGCTCTATGGGATACTGCGTACGTTGACATACCCTTACTTCAAACGTATATGCCTACTTTCGTTCTCTTCTAGTG
GCCAGGAAGAATACGAAGTATGTTTCTTCCAAATTCTCAACGATGCATGCTTCCCTCAACAATACTTTTCAGCGA
CTGCGGCCCATGTCATATGCCCATTCCCATGTCATCCTCATTGCCTTCGCTCTTGATACCCCTGACTCGTTAGAA
AACGTCACAACAAAGGCATGTCCCTCTTTTGTTTCTCTCTCATCAGTGAATTGATGATGTGAGCAGTGGATCGAG
GAGGTCCGCGAGCTCTGTGGTGCCAGCATCCCCGTCATTCTAGTAGGCTGCAAAGCAGACCTTCGGCCGAATACT
GACCATCCGAACACACCGGACAACCCTTGTACTTGGGTGACACGGGAGATGGGTGAACGTGTCGCTCAAGCTATC
GGGGCTCGTGCATATAAAGAATGTTCAGCACTCAGAATCGAAGGTGTCGATGACGTCTTTGAAGCCGCCACGAGG
GCTAGCATGCTAATGCGAGAGGGTGTTCCCAGTCATCCTCAAGCTGCAGAGGCGAGACAGACCCGAAGACGGAGT
GTAGGGAAGGCCGCATCAGACGAGACTGGAGATGGATGGAAATGTTGTATTATCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail