Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043320
Gene name
Locationscaffold_2:1215452..1217631
Strand-
Gene length (bp)2179
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 2.3E-90 36 450
PF00686 CBM_20 Starch binding domain 2.1E-27 482 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 21 574 0.0E+00
sp|D8Q9M3|AMYG_SCHCM Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_57589 PE=1 SV=1 1 574 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 24 574 3.0E-176
sp|P0DN29|AMYG_ARTBC Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-1 PE=1 SV=1 1 574 3.0E-167
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 20 489 4.0E-163
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 21 574 0.0E+00
sp|D8Q9M3|AMYG_SCHCM Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_57589 PE=1 SV=1 1 574 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 24 574 3.0E-176
sp|P0DN29|AMYG_ARTBC Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-1 PE=1 SV=1 1 574 3.0E-167
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 20 489 4.0E-163
sp|P69328|AMYG_ASPNG Glucoamylase OS=Aspergillus niger GN=GLAA PE=1 SV=1 20 477 4.0E-162
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 20 477 4.0E-162
sp|P23176|AMYG_ASPKA Glucoamylase I OS=Aspergillus kawachii GN=gaI PE=1 SV=1 20 489 5.0E-162
sp|Q03045|AMYG_AMORE Glucoamylase P OS=Amorphotheca resinae GN=GAMP PE=1 SV=1 8 573 8.0E-162
sp|P07683|AMYG_RHIOR Glucoamylase 1 OS=Rhizopus oryzae PE=1 SV=2 23 456 5.0E-78
sp|O60087|AMYG_SCHPO Probable glucoamylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu17 PE=2 SV=1 14 457 1.0E-77
sp|P42042|AMYG_BLAAD Glucoamylase OS=Blastobotrys adeninivorans GN=GAA PE=3 SV=1 31 457 9.0E-71
sp|I1BYW6|AMYD_RHIO9 Glucoamylase amyD OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=amyD PE=1 SV=1 19 456 9.0E-71
sp|P26989|AMYH_SACFI Glucoamylase GLA1 OS=Saccharomycopsis fibuligera GN=GLA1 PE=3 SV=2 23 457 1.0E-59
sp|P08017|AMYG_SACFI Glucoamylase GLU1 OS=Saccharomycopsis fibuligera GN=GLU1 PE=1 SV=1 23 457 2.0E-57
sp|P08019|AMYG_YEAST Glucoamylase, intracellular sporulation-specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGA1 PE=3 SV=2 22 458 8.0E-49
sp|P04065|AMYH_YEASX Glucoamylase S1 OS=Saccharomyces cerevisiae GN=STA1 PE=3 SV=2 22 410 6.0E-41
sp|P29760|AMYI_YEASX Glucoamylase S2 OS=Saccharomyces cerevisiae GN=STA2 PE=3 SV=1 22 410 9.0E-41
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 480 574 2.0E-20
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 483 574 6.0E-18
sp|P69328|AMYG_ASPNG Glucoamylase OS=Aspergillus niger GN=GLAA PE=1 SV=1 483 574 6.0E-18
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 484 574 4.0E-17
sp|P30270|AMY_STRGR Alpha-amylase OS=Streptomyces griseus GN=amy PE=3 SV=1 484 574 4.0E-17
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 488 574 4.0E-15
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 488 574 4.0E-15
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 477 573 1.0E-14
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 477 574 8.0E-14
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 477 574 2.0E-13
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 477 574 5.0E-13
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 477 573 1.0E-12
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 477 574 1.0E-12
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 488 574 1.0E-11
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 483 574 2.0E-11
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 477 574 2.0E-11
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 488 574 3.0E-11
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 477 574 4.0E-11
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 477 574 5.0E-11
sp|P29750|AMY_THECU Alpha-amylase OS=Thermomonospora curvata GN=tam PE=1 SV=1 459 551 2.0E-08
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 488 574 4.0E-08
sp|P19584|AMYB_THETU Thermophilic beta-amylase OS=Thermoanaerobacterium thermosulfurigenes PE=1 SV=1 480 574 4.0E-08
sp|Q59005|Y1610_METJA Uncharacterized glycosyl hydrolase MJ1610 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1610 PE=3 SV=1 55 448 9.0E-08
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 477 574 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 237.54 122.93 352.14
Initials Initials knots 197.08 111.85 282.31
Pileal_Stipeal_center Stage I stipe center 280.86 152.87 408.85
Pileal_Stipeal_shell Stage I stipe shell 185.13 106.16 264.10
DIF_stipe_center Stage II stipe center 257.05 142.36 371.74
DIF_stipe_shell Stage II stipe shell 435.52 221.73 649.31
DIF_stipe_skin Stage II stipe skin 369.11 191.85 546.36
DIF_cap_skin Stage II cap skin 283.33 154.38 412.28
DIF_cap_tissue Stage II cap tissue 312.40 164.88 459.93
DIF_gill_tissue Stage II gill tissue 212.81 118.57 307.05
YFB_stipe_center Young fruiting body stipe center 348.38 182.37 514.39
YFB_stipe_shell Young fruiting body stipe shell 559.12 253.54 864.71
YFB_stipe_skin Young fruiting body stipe skin 700.32 318.03 1082.62
YFB_cap_skin Young fruiting body cap skin 360.32 188.99 531.65
YFB_cap_tissue Young fruiting body cap tissue 758.85 315.90 1201.79
YFB_gill_tissue Young fruiting body gill tissue 264.03 139.70 388.37
YFB_veil Young fruiting body veil 206.37 116.12 296.62

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.839852 no
Casing YFB_stipe_center 0.317425 no
Casing YFB_stipe_shell 0.010412 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.258084 no
Casing YFB_cap_tissue 0.001140 yes
Casing YFB_gill_tissue 0.852643 no
Casing YFB_veil 0.787297 no
Casing Initials 0.683703 no
Casing Pileal_Stipeal_center 0.735374 no
Casing Pileal_Stipeal_shell 0.543190 no
Casing DIF_stipe_center 0.893619 no
Casing DIF_stipe_shell 0.074478 no
Casing DIF_stipe_skin 0.223600 no
Casing DIF_cap_skin 0.715816 no
Casing DIF_cap_tissue 0.514137 no
DIF_gill_tissue YFB_stipe_center 0.123509 no
DIF_gill_tissue YFB_stipe_shell 0.002525 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.094821 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.605386 no
DIF_gill_tissue YFB_veil 0.958838 no
YFB_stipe_center YFB_stipe_shell 0.208910 no
YFB_stipe_center YFB_stipe_skin 0.042041 yes
YFB_stipe_center YFB_cap_skin 0.959887 no
YFB_stipe_center YFB_cap_tissue 0.030610 yes
YFB_stipe_center YFB_gill_tissue 0.503521 no
YFB_stipe_center YFB_veil 0.104432 no
YFB_stipe_shell YFB_stipe_skin 0.670634 no
YFB_stipe_shell YFB_cap_skin 0.255805 no
YFB_stipe_shell YFB_cap_tissue 0.546198 no
YFB_stipe_shell YFB_gill_tissue 0.022892 yes
YFB_stipe_shell YFB_veil 0.002951 yes
YFB_stipe_skin YFB_cap_skin 0.052745 no
YFB_stipe_skin YFB_cap_tissue 0.909444 no
YFB_stipe_skin YFB_gill_tissue 0.003765 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.041603 yes
YFB_cap_skin YFB_gill_tissue 0.430182 no
YFB_cap_skin YFB_veil 0.083669 no
YFB_cap_tissue YFB_gill_tissue 0.002084 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.541537 no
Initials DIF_gill_tissue 0.888030 no
Initials YFB_stipe_center 0.067147 no
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.049046 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.437934 no
Initials YFB_veil 0.935843 no
Initials Pileal_Stipeal_center 0.301178 no
Initials Pileal_Stipeal_shell 0.908823 no
Initials DIF_stipe_center 0.477432 no
Initials DIF_stipe_shell 0.010728 yes
Initials DIF_stipe_skin 0.035765 yes
Initials DIF_cap_skin 0.279372 no
Initials DIF_cap_tissue 0.146187 no
Pileal_Stipeal_center DIF_gill_tissue 0.460023 no
Pileal_Stipeal_center YFB_stipe_center 0.625351 no
Pileal_Stipeal_center YFB_stipe_shell 0.039390 yes
Pileal_Stipeal_center YFB_stipe_skin 0.006742 yes
Pileal_Stipeal_center YFB_cap_skin 0.548976 no
Pileal_Stipeal_center YFB_cap_tissue 0.003365 yes
Pileal_Stipeal_center YFB_gill_tissue 0.915760 no
Pileal_Stipeal_center YFB_veil 0.392277 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.189390 no
Pileal_Stipeal_center DIF_stipe_center 0.868437 no
Pileal_Stipeal_center DIF_stipe_shell 0.209955 no
Pileal_Stipeal_center DIF_stipe_skin 0.495365 no
Pileal_Stipeal_center DIF_cap_skin 0.988778 no
Pileal_Stipeal_center DIF_cap_tissue 0.839852 no
Pileal_Stipeal_shell DIF_gill_tissue 0.757537 no
Pileal_Stipeal_shell YFB_stipe_center 0.034377 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.025205 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.292985 no
Pileal_Stipeal_shell YFB_veil 0.827384 no
Pileal_Stipeal_shell DIF_stipe_center 0.324970 no
Pileal_Stipeal_shell DIF_stipe_shell 0.005671 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.017507 yes
Pileal_Stipeal_shell DIF_cap_skin 0.168934 no
Pileal_Stipeal_shell DIF_cap_tissue 0.079655 no
DIF_stipe_center DIF_gill_tissue 0.653430 no
DIF_stipe_center YFB_stipe_center 0.426345 no
DIF_stipe_center YFB_stipe_shell 0.017783 yes
DIF_stipe_center YFB_stipe_skin 0.002084 yes
DIF_stipe_center YFB_cap_skin 0.360018 no
DIF_stipe_center YFB_cap_tissue 0.002084 yes
DIF_stipe_center YFB_gill_tissue 0.965214 no
DIF_stipe_center YFB_veil 0.588640 no
DIF_stipe_center DIF_stipe_shell 0.108233 no
DIF_stipe_center DIF_stipe_skin 0.313162 no
DIF_stipe_center DIF_cap_skin 0.853079 no
DIF_stipe_center DIF_cap_tissue 0.651386 no
DIF_stipe_shell DIF_gill_tissue 0.020260 yes
DIF_stipe_shell YFB_stipe_center 0.629215 no
DIF_stipe_shell YFB_stipe_shell 0.599428 no
DIF_stipe_shell YFB_stipe_skin 0.215960 no
DIF_stipe_shell YFB_cap_skin 0.695529 no
DIF_stipe_shell YFB_cap_tissue 0.153551 no
DIF_stipe_shell YFB_gill_tissue 0.141262 no
DIF_stipe_shell YFB_veil 0.015242 yes
DIF_stipe_shell DIF_stipe_skin 0.744880 no
DIF_stipe_shell DIF_cap_skin 0.215044 no
DIF_stipe_shell DIF_cap_tissue 0.393961 no
DIF_stipe_skin DIF_gill_tissue 0.080179 no
DIF_stipe_skin YFB_stipe_center 0.925909 no
DIF_stipe_skin YFB_stipe_shell 0.290161 no
DIF_stipe_skin YFB_stipe_skin 0.065465 no
DIF_stipe_skin YFB_cap_skin 0.971494 no
DIF_stipe_skin YFB_cap_tissue 0.051318 no
DIF_stipe_skin YFB_gill_tissue 0.379207 no
DIF_stipe_skin YFB_veil 0.063760 no
DIF_stipe_skin DIF_cap_skin 0.512002 no
DIF_stipe_skin DIF_cap_tissue 0.730651 no
DIF_cap_skin DIF_gill_tissue 0.441846 no
DIF_cap_skin YFB_stipe_center 0.644700 no
DIF_cap_skin YFB_stipe_shell 0.042260 yes
DIF_cap_skin YFB_stipe_skin 0.007092 yes
DIF_cap_skin YFB_cap_skin 0.566602 no
DIF_cap_skin YFB_cap_tissue 0.003365 yes
DIF_cap_skin YFB_gill_tissue 0.903062 no
DIF_cap_skin YFB_veil 0.373177 no
DIF_cap_skin DIF_cap_tissue 0.856338 no
DIF_cap_tissue DIF_gill_tissue 0.263495 no
DIF_cap_tissue YFB_stipe_center 0.844727 no
DIF_cap_tissue YFB_stipe_shell 0.093175 no
DIF_cap_tissue YFB_stipe_skin 0.018344 yes
DIF_cap_tissue YFB_cap_skin 0.779917 no
DIF_cap_tissue YFB_cap_tissue 0.008791 yes
DIF_cap_tissue YFB_gill_tissue 0.719785 no
DIF_cap_tissue YFB_veil 0.211586 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043320
MRISSAFLWTSLALSWGAYAQSSSVDAYLAAESPIAKAGLLANIGPSGSKSAGAKAGIVIASPSHSDPDYLFTWT
RDASLVFAVIIDQYTLGLDTSLRSHIDNFVSSQKIIQQVSNPSGTISTGGLGEPKFNIDETAFTGSWGRPQRDGP
ALRANALITWSNHLLKQNNASYVTGTLWPIIKLDLDYIKNTWNQSSFDLWEEVSSSSFFTTAVQHRSLRQGAALA
TAIRETSVVADYTKQADNLLCFMQSYWNTAGYMTANTGGGRTGKDANTVLASIHTFDAAAGCDAATFQPCSDRAL
ANLVAYVNAFRSIYAINSGVPSNIGIATGRYAEDVYFGGNPWYLTTLAVAEQLYDALIVWKNQGSITVTNLSKPF
FSLFSSGISTGTFSSSSSTFNTLITGVQNYADSFVNVVAKHTPSGGGLAEQYSRNDGNPLSAFDLTWSYASLLTA
DGARNGVVPASWGAKGLTVPGTCSGNSGPTAHVTFNVNAETVFGENIFVTGSVGALANWSPDNAIALNADNYPIW
SVAIDIPASTNVEYKYIRKFNGGVTWESDPNRRFTSPASGSSTLNDVWR*
Coding >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCAT
ATCGATAATTTTGTTTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGC
CTCGGTGAACCAAAGTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGTCGTCCTCAACGAGATGGTCCT
GCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAAAACAACGCGTCCTACGTCACTGGC
ACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGGAATCAGTCTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGTCA
TACTGGAATACAGCAGGTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTC
GCTAGTATCCACACCTTCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTG
GCCAATCTCGTCGCATACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGT
ATTGCGACTGGAAGATATGCAGAGGATGTGTATTTCGGTGGGAATCCATGGTACTTGACGACTTTGGCGGTTGCG
GAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAGGCTCAATCACAGTCACGAATCTATCCAAGCCATTC
TTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTTCTTCTTCTTCCAGCACCTTCAATACTCTGATTACA
GGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTGCGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAG
CAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTGATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCT
GATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTGCCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGG
AACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATGCTGAAACGGTGTTCGGAGAGAATATCTTTGTGACT
GGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCAGATAATTATCCCATTTGG
AGTGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGTTACC
TGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCGATAG
Transcript >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCAT
ATCGATAATTTTGTTTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGC
CTCGGTGAACCAAAGTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGTCGTCCTCAACGAGATGGTCCT
GCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAAAACAACGCGTCCTACGTCACTGGC
ACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGGAATCAGTCTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGTCA
TACTGGAATACAGCAGGTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTC
GCTAGTATCCACACCTTCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTG
GCCAATCTCGTCGCATACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGT
ATTGCGACTGGAAGATATGCAGAGGATGTGTATTTCGGTGGGAATCCATGGTACTTGACGACTTTGGCGGTTGCG
GAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAGGCTCAATCACAGTCACGAATCTATCCAAGCCATTC
TTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTTCTTCTTCTTCCAGCACCTTCAATACTCTGATTACA
GGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTGCGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAG
CAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTGATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCT
GATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTGCCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGG
AACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATGCTGAAACGGTGTTCGGAGAGAATATCTTTGTGACT
GGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCAGATAATTATCCCATTTGG
AGTGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGTTACC
TGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCGATAG
Gene >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAGTAAGTCATCGTACTACGACTATCAAAATTGCAAACT
ATTGCCAACTAATCAAACATTCAGATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCATATCGATAATTTTGT
TTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGCCTCGGTGAACCAAA
GTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGGTAAGTCGGCCAATTGCACGAACTTTCTGTAATGCT
GAATCTTGATTTGATTTTTAGTCGTCCTCAACGAGGTTCGTTCTGATTGTTGCGTGTCTGAACAGCGCCTGTACT
GAGAATGATGTCTTAGATGGTCCTGCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAA
AACAACGCGTCCTACGTCACTGGCACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGG
AATCAGTCTAGGTACGTGTTTCATTCTAATGCTTTAATTGTTGGCTCTAAACGTTGAATTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGGTT
TGTTTATACTTCGTTGAGTGCAAAGTGAAGCATACACTGATCAGTTTTTATCCTAGTCATACTGGAATACAGCAG
GTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTCGCTAGTATCCACACCT
TCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTGGCCAATCTCGTCGCAT
ACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGTATTGCGACTGGAAGAT
ATGCAGAGGATGTGTATTTCGGTGGGAATGTATGTTTCTCTCTGAAATTACATGTTTGTCGTGGCTAAATCGTCT
CAAAGCCATGGTACTTGACGACTTTGGCGGTTGCGGAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAG
GCTCAATCACAGTCACGAATCTATCCAAGCCATTCTTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTT
CTTCTTCTTCCAGCACCTTCAATACTCTGATTACAGGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTG
CGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAGCAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTG
ATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCTGATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTG
CCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGGAACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATG
CTGAAACGGTGTTCGGAGGTACCTTTTTTCCCTCTCACTTTTACGAACAGGAATGACTCATGACATATGGAAACA
GAGAATATCTTTGTGACTGGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCA
GATAATTATCCCATTTGGAGTGGTAAGTCCTCAATCCCTCTCCTGCCTTTCGGTGATCCTTTTCGCTGAAGATGT
TCCTCTAGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGT
TACCTGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCG
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail