Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043320
Gene name
Locationscaffold_2:1215452..1217631
Strand-
Gene length (bp)2179
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15 2.3E-90 36 450
PF00686 CBM_20 Starch binding domain 2.1E-27 482 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 21 574 0.0E+00
sp|D8Q9M3|AMYG_SCHCM Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_57589 PE=1 SV=1 1 574 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 24 574 3.0E-176
sp|P0DN29|AMYG_ARTBC Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-1 PE=1 SV=1 1 574 3.0E-167
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 20 489 4.0E-163
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36914|AMYG_ASPOR Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=glaA PE=2 SV=2 21 574 0.0E+00
sp|D8Q9M3|AMYG_SCHCM Glucoamylase ARB_02327-1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_57589 PE=1 SV=1 1 574 0.0E+00
sp|P14804|AMYG_NEUCR Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gla-1 PE=1 SV=3 24 574 3.0E-176
sp|P0DN29|AMYG_ARTBC Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-1 PE=1 SV=1 1 574 3.0E-167
sp|P22832|AMYG_ASPSH Glucoamylase OS=Aspergillus shirousami GN=glaA PE=3 SV=1 20 489 4.0E-163
sp|P69328|AMYG_ASPNG Glucoamylase OS=Aspergillus niger GN=GLAA PE=1 SV=1 20 477 4.0E-162
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 20 477 4.0E-162
sp|P23176|AMYG_ASPKA Glucoamylase I OS=Aspergillus kawachii GN=gaI PE=1 SV=1 20 489 5.0E-162
sp|Q03045|AMYG_AMORE Glucoamylase P OS=Amorphotheca resinae GN=GAMP PE=1 SV=1 8 573 8.0E-162
sp|P07683|AMYG_RHIOR Glucoamylase 1 OS=Rhizopus oryzae PE=1 SV=2 23 456 5.0E-78
sp|O60087|AMYG_SCHPO Probable glucoamylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu17 PE=2 SV=1 14 457 1.0E-77
sp|P42042|AMYG_BLAAD Glucoamylase OS=Blastobotrys adeninivorans GN=GAA PE=3 SV=1 31 457 9.0E-71
sp|I1BYW6|AMYD_RHIO9 Glucoamylase amyD OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=amyD PE=1 SV=1 19 456 9.0E-71
sp|P26989|AMYH_SACFI Glucoamylase GLA1 OS=Saccharomycopsis fibuligera GN=GLA1 PE=3 SV=2 23 457 1.0E-59
sp|P08017|AMYG_SACFI Glucoamylase GLU1 OS=Saccharomycopsis fibuligera GN=GLU1 PE=1 SV=1 23 457 2.0E-57
sp|P08019|AMYG_YEAST Glucoamylase, intracellular sporulation-specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGA1 PE=3 SV=2 22 458 8.0E-49
sp|P04065|AMYH_YEASX Glucoamylase S1 OS=Saccharomyces cerevisiae GN=STA1 PE=3 SV=2 22 410 6.0E-41
sp|P29760|AMYI_YEASX Glucoamylase S2 OS=Saccharomyces cerevisiae GN=STA2 PE=3 SV=1 22 410 9.0E-41
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 480 574 2.0E-20
sp|P69327|AMYG_ASPAW Glucoamylase OS=Aspergillus awamori GN=GLAA PE=1 SV=1 483 574 6.0E-18
sp|P69328|AMYG_ASPNG Glucoamylase OS=Aspergillus niger GN=GLAA PE=1 SV=1 483 574 6.0E-18
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 484 574 4.0E-17
sp|P30270|AMY_STRGR Alpha-amylase OS=Streptomyces griseus GN=amy PE=3 SV=1 484 574 4.0E-17
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 488 574 4.0E-15
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 488 574 4.0E-15
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 477 573 1.0E-14
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 477 574 8.0E-14
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 477 574 2.0E-13
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 477 574 5.0E-13
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 477 573 1.0E-12
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 477 574 1.0E-12
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 488 574 1.0E-11
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 483 574 2.0E-11
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 477 574 2.0E-11
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 488 574 3.0E-11
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 477 574 4.0E-11
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 477 574 5.0E-11
sp|P29750|AMY_THECU Alpha-amylase OS=Thermomonospora curvata GN=tam PE=1 SV=1 459 551 2.0E-08
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 488 574 4.0E-08
sp|P19584|AMYB_THETU Thermophilic beta-amylase OS=Thermoanaerobacterium thermosulfurigenes PE=1 SV=1 480 574 4.0E-08
sp|Q59005|Y1610_METJA Uncharacterized glycosyl hydrolase MJ1610 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1610 PE=3 SV=1 55 448 9.0E-08
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 477 574 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043320
MRISSAFLWTSLALSWGAYAQSSSVDAYLAAESPIAKAGLLANIGPSGSKSAGAKAGIVIASPSHSDPDYLFTWT
RDASLVFAVIIDQYTLGLDTSLRSHIDNFVSSQKIIQQVSNPSGTISTGGLGEPKFNIDETAFTGSWGRPQRDGP
ALRANALITWSNHLLKQNNASYVTGTLWPIIKLDLDYIKNTWNQSSFDLWEEVSSSSFFTTAVQHRSLRQGAALA
TAIRETSVVADYTKQADNLLCFMQSYWNTAGYMTANTGGGRTGKDANTVLASIHTFDAAAGCDAATFQPCSDRAL
ANLVAYVNAFRSIYAINSGVPSNIGIATGRYAEDVYFGGNPWYLTTLAVAEQLYDALIVWKNQGSITVTNLSKPF
FSLFSSGISTGTFSSSSSTFNTLITGVQNYADSFVNVVAKHTPSGGGLAEQYSRNDGNPLSAFDLTWSYASLLTA
DGARNGVVPASWGAKGLTVPGTCSGNSGPTAHVTFNVNAETVFGENIFVTGSVGALANWSPDNAIALNADNYPIW
SVAIDIPASTNVEYKYIRKFNGGVTWESDPNRRFTSPASGSSTLNDVWR*
Coding >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCAT
ATCGATAATTTTGTTTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGC
CTCGGTGAACCAAAGTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGTCGTCCTCAACGAGATGGTCCT
GCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAAAACAACGCGTCCTACGTCACTGGC
ACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGGAATCAGTCTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGTCA
TACTGGAATACAGCAGGTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTC
GCTAGTATCCACACCTTCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTG
GCCAATCTCGTCGCATACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGT
ATTGCGACTGGAAGATATGCAGAGGATGTGTATTTCGGTGGGAATCCATGGTACTTGACGACTTTGGCGGTTGCG
GAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAGGCTCAATCACAGTCACGAATCTATCCAAGCCATTC
TTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTTCTTCTTCTTCCAGCACCTTCAATACTCTGATTACA
GGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTGCGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAG
CAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTGATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCT
GATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTGCCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGG
AACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATGCTGAAACGGTGTTCGGAGAGAATATCTTTGTGACT
GGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCAGATAATTATCCCATTTGG
AGTGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGTTACC
TGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCGATAG
Transcript >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCAT
ATCGATAATTTTGTTTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGC
CTCGGTGAACCAAAGTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGTCGTCCTCAACGAGATGGTCCT
GCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAAAACAACGCGTCCTACGTCACTGGC
ACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGGAATCAGTCTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGTCA
TACTGGAATACAGCAGGTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTC
GCTAGTATCCACACCTTCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTG
GCCAATCTCGTCGCATACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGT
ATTGCGACTGGAAGATATGCAGAGGATGTGTATTTCGGTGGGAATCCATGGTACTTGACGACTTTGGCGGTTGCG
GAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAGGCTCAATCACAGTCACGAATCTATCCAAGCCATTC
TTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTTCTTCTTCTTCCAGCACCTTCAATACTCTGATTACA
GGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTGCGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAG
CAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTGATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCT
GATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTGCCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGG
AACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATGCTGAAACGGTGTTCGGAGAGAATATCTTTGTGACT
GGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCAGATAATTATCCCATTTGG
AGTGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGTTACC
TGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCGATAG
Gene >AgabiH97|043320
ATGCGTATTTCTTCAGCATTCCTCTGGACTAGTTTGGCGCTCTCATGGGGAGCCTATGCACAGTCCAGTTCTGTT
GATGCATATCTAGCCGCTGAATCCCCGATAGCCAAAGCAGGTCTACTTGCCAACATTGGACCTTCTGGTTCCAAG
TCAGCAGGTGCTAAAGCAGGAATAGTAATCGCCTCTCCATCACATTCGGACCCTGACTATCTGTTTACCTGGACT
CGTGATGCCTCGCTCGTGTTTGCGGTAATCATTGACCAGTAAGTCATCGTACTACGACTATCAAAATTGCAAACT
ATTGCCAACTAATCAAACATTCAGATACACGTTGGGTCTGGATACTTCTCTGCGAAGTCATATCGATAATTTTGT
TTCCTCACAAAAGATTATACAACAAGTGTCTAATCCATCGGGAACGATTAGTACCGGTGGCCTCGGTGAACCAAA
GTTTAACATCGATGAAACGGCTTTCACTGGTTCATGGGGGTAAGTCGGCCAATTGCACGAACTTTCTGTAATGCT
GAATCTTGATTTGATTTTTAGTCGTCCTCAACGAGGTTCGTTCTGATTGTTGCGTGTCTGAACAGCGCCTGTACT
GAGAATGATGTCTTAGATGGTCCTGCCCTAAGAGCCAATGCTCTCATCACCTGGTCGAATCACCTTCTTAAACAA
AACAACGCGTCCTACGTCACTGGCACATTGTGGCCCATCATCAAGCTCGACCTCGACTACATAAAAAATACCTGG
AATCAGTCTAGGTACGTGTTTCATTCTAATGCTTTAATTGTTGGCTCTAAACGTTGAATTAGTTTCGACTTGTGG
GAAGAAGTATCATCCTCGTCTTTCTTCACCACTGCCGTGCAACACCGTTCACTCCGCCAAGGCGCAGCATTGGCC
ACTGCAATCCGCGAAACTTCTGTCGTGGCCGATTATACAAAACAAGCGGACAACCTTCTGTGCTTCATGCAGGTT
TGTTTATACTTCGTTGAGTGCAAAGTGAAGCATACACTGATCAGTTTTTATCCTAGTCATACTGGAATACAGCAG
GTTATATGACTGCAAACACGGGTGGTGGTCGTACAGGTAAAGATGCAAATACTGTTCTCGCTAGTATCCACACCT
TCGATGCTGCTGCTGGTTGCGACGCTGCCACTTTCCAACCTTGCTCTGACCGTGCCCTGGCCAATCTCGTCGCAT
ACGTTAACGCCTTCCGAAGCATATATGCCATCAACTCGGGTGTTCCATCAAACATCGGTATTGCGACTGGAAGAT
ATGCAGAGGATGTGTATTTCGGTGGGAATGTATGTTTCTCTCTGAAATTACATGTTTGTCGTGGCTAAATCGTCT
CAAAGCCATGGTACTTGACGACTTTGGCGGTTGCGGAACAACTCTATGATGCTTTGATCGTCTGGAAAAACCAAG
GCTCAATCACAGTCACGAATCTATCCAAGCCATTCTTTTCACTCTTCTCGTCTGGCATTTCTACCGGCACTTTTT
CTTCTTCTTCCAGCACCTTCAATACTCTGATTACAGGAGTCCAAAACTATGCCGATAGCTTCGTGAATGTCGTTG
CGAAGCATACACCCTCTGGTGGAGGCCTTGCTGAGCAGTACAGCCGCAATGACGGGAATCCTCTCAGTGCATTTG
ATTTGACTTGGAGCTATGCTTCCCTCTTAACGGCTGATGGTGCCAGAAATGGTGTTGTTCCTGCGAGTTGGGGTG
CCAAAGGGCTTACCGTGCCCGGAACTTGCTCAGGGAACAGTGGACCCACTGCTCATGTCACTTTCAATGTTAATG
CTGAAACGGTGTTCGGAGGTACCTTTTTTCCCTCTCACTTTTACGAACAGGAATGACTCATGACATATGGAAACA
GAGAATATCTTTGTGACTGGCTCCGTTGGCGCTTTGGCAAACTGGTCTCCTGATAACGCAATTGCTCTCAATGCA
GATAATTATCCCATTTGGAGTGGTAAGTCCTCAATCCCTCTCCTGCCTTTCGGTGATCCTTTTCGCTGAAGATGT
TCCTCTAGTGGCCATTGACATCCCAGCAAGCACGAATGTAGAATATAAATATATTCGCAAGTTCAACGGCGGAGT
TACCTGGGAATCGGACCCTAATAGACGGTTCACGTCTCCAGCAAGTGGGAGCTCTACCCTCAATGATGTTTGGCG
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail