Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043200
Gene name
Locationscaffold_2:1180415..1182655
Strand+
Gene length (bp)2240
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 5.9E-15 12 111
PF04820 Trp_halogenase Tryptophan halogenase 2.7E-10 201 423
PF01494 FAD_binding_3 FAD binding domain 3.1E-11 11 140
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-05 15 42
PF01134 GIDA Glucose inhibited division protein A 1.8E-05 12 41

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 8 493 8.0E-68

GO

GO Term Description Terminal node
GO:0004497 monooxygenase activity Yes
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043200
MATSSLPPKHTQVLVIGGGPAGSYAASALAREGIKVTLLEASKFPRYHIGESLIPSVRHYLRFIGAEDKLANHGF
VPKPGSAIKFNQFKREGYTDFVALGHNNNAWNVVRSEFDQLLLNHARTSGAAVYEQTKVDAIHFDPMNPERPVSV
SWTHIPPAGLPSPPPSPTTSTFSRFLRRFSNAEQPSNVGGPIQGTTAFTHVIDASGRAGLMSVRYLHNRRFNASL
KNIAIWGYWNGVENYGEGTRRSGAPWFEALTDESGWAWFIPLHNGTTSIGIVVNQKVYNAKADALPSPPFDGAQI
PNPDASSLTARYLSNLNFTPGVVRLIGEGKLVEGSVKTASDFSYSAPAYAGPNYRIVGDAGAFIDPFFSSGVHLA
MTSALSAAATICASIRGNCSEALAASWHTQRVATSYTRFQVVVLSAYKQIRSQADGILSDIDEDNYDRAFAFLRP
VIQGASEMGARLSENELQKSLDFCVKLFDPTTPEDHQRASLMNGLSCDLLDVGTPIIDPSILEKTLDGDCFMPYD
EDSGSDAEKADETKMVLHKVNARRVIHSEYAINNMEIENLEGYVVRLERWKLGLVKMRSPTKN*
Coding >AgabiH97|043200
ATGGCTACCTCTTCCTTACCTCCCAAGCATACACAAGTCCTTGTTATTGGCGGGGGACCAGCCGGGTCCTACGCT
GCCTCTGCCCTTGCGCGCGAAGGTATCAAAGTCACTCTCCTGGAAGCATCCAAATTCCCAAGGTATCATATCGGA
GAGAGTTTGATCCCATCCGTACGCCACTATCTTAGGTTCATCGGTGCGGAAGACAAGCTAGCCAACCATGGGTTC
GTACCCAAGCCCGGCTCCGCTATCAAATTCAATCAGTTCAAACGTGAAGGATATACTGATTTTGTGGCACTCGGC
CACAACAATAACGCCTGGAACGTTGTACGATCTGAGTTTGATCAGCTGTTGCTCAACCATGCCCGTACGTCGGGC
GCCGCAGTATATGAACAAACCAAAGTAGATGCCATTCATTTTGACCCAATGAATCCGGAAAGACCTGTGTCTGTT
TCATGGACGCATATTCCACCAGCAGGGCTGCCTTCGCCTCCGCCATCCCCGACGACATCCACATTCTCAAGATTC
TTGCGGCGGTTCAGCAACGCTGAACAACCGTCGAATGTGGGCGGGCCCATCCAGGGCACCACTGCCTTTACGCAT
GTTATTGATGCATCTGGCCGCGCAGGTCTTATGTCTGTACGATATCTGCACAACAGACGCTTCAACGCGTCGCTG
AAGAATATCGCGATTTGGGGCTACTGGAACGGCGTCGAAAATTACGGCGAAGGAACAAGGCGGAGTGGAGCTCCC
TGGTTTGAAGCGTTGACAGACGAGTCGGGTTGGGCGTGGTTCATTCCCCTCCACAACGGTACAACTTCCATTGGT
ATTGTCGTCAATCAAAAGGTCTACAATGCCAAAGCGGACGCCCTCCCGTCTCCTCCATTCGACGGCGCCCAAATT
CCCAATCCGGATGCGTCCAGTCTCACTGCTCGCTACTTGTCCAATCTGAACTTCACTCCGGGCGTTGTGCGCCTC
ATCGGGGAAGGGAAGCTCGTCGAAGGCAGCGTCAAAACTGCCAGTGACTTTAGCTATTCAGCTCCTGCATATGCT
GGACCCAATTATAGAATTGTTGGAGATGCAGGCGCATTTATCGACCCATTTTTCTCCAGTGGTGTCCACCTTGCT
ATGACTTCAGCGCTTTCCGCTGCCGCGACCATTTGCGCCTCCATCCGTGGTAATTGCTCAGAAGCGCTAGCTGCT
TCCTGGCACACTCAGAGGGTGGCAACAAGCTATACCAGATTCCAAGTTGTCGTTCTCAGCGCATACAAGCAGATC
AGATCTCAGGCCGACGGTATTCTTTCCGACATTGACGAGGACAATTATGATCGTGCTTTCGCATTTCTTCGACCA
GTCATCCAAGGTGCTTCCGAGATGGGTGCTCGCCTTTCTGAAAACGAGCTTCAGAAGTCACTCGATTTTTGCGTC
AAGCTTTTTGATCCGACGACTCCAGAGGATCATCAGCGCGCTTCGCTTATGAATGGCCTTTCCTGTGACCTTCTT
GACGTCGGTACCCCTATCATTGATCCCAGTATCCTCGAGAAGACTTTGGATGGTGACTGCTTCATGCCATATGAC
GAGGATTCTGGTTCAGATGCAGAGAAGGCCGATGAAACCAAGATGGTGCTCCACAAAGTTAACGCGAGGCGGGTC
ATTCATTCTGAGTACGCCATAAACAACATGGAAATCGAGAACCTGGAAGGCTACGTCGTCCGCCTCGAAAGGTGG
AAGCTCGGACTCGTCAAAATGAGATCTCCCACCAAAAACTAA
Transcript >AgabiH97|043200
ATGGCTACCTCTTCCTTACCTCCCAAGCATACACAAGTCCTTGTTATTGGCGGGGGACCAGCCGGGTCCTACGCT
GCCTCTGCCCTTGCGCGCGAAGGTATCAAAGTCACTCTCCTGGAAGCATCCAAATTCCCAAGGTATCATATCGGA
GAGAGTTTGATCCCATCCGTACGCCACTATCTTAGGTTCATCGGTGCGGAAGACAAGCTAGCCAACCATGGGTTC
GTACCCAAGCCCGGCTCCGCTATCAAATTCAATCAGTTCAAACGTGAAGGATATACTGATTTTGTGGCACTCGGC
CACAACAATAACGCCTGGAACGTTGTACGATCTGAGTTTGATCAGCTGTTGCTCAACCATGCCCGTACGTCGGGC
GCCGCAGTATATGAACAAACCAAAGTAGATGCCATTCATTTTGACCCAATGAATCCGGAAAGACCTGTGTCTGTT
TCATGGACGCATATTCCACCAGCAGGGCTGCCTTCGCCTCCGCCATCCCCGACGACATCCACATTCTCAAGATTC
TTGCGGCGGTTCAGCAACGCTGAACAACCGTCGAATGTGGGCGGGCCCATCCAGGGCACCACTGCCTTTACGCAT
GTTATTGATGCATCTGGCCGCGCAGGTCTTATGTCTGTACGATATCTGCACAACAGACGCTTCAACGCGTCGCTG
AAGAATATCGCGATTTGGGGCTACTGGAACGGCGTCGAAAATTACGGCGAAGGAACAAGGCGGAGTGGAGCTCCC
TGGTTTGAAGCGTTGACAGACGAGTCGGGTTGGGCGTGGTTCATTCCCCTCCACAACGGTACAACTTCCATTGGT
ATTGTCGTCAATCAAAAGGTCTACAATGCCAAAGCGGACGCCCTCCCGTCTCCTCCATTCGACGGCGCCCAAATT
CCCAATCCGGATGCGTCCAGTCTCACTGCTCGCTACTTGTCCAATCTGAACTTCACTCCGGGCGTTGTGCGCCTC
ATCGGGGAAGGGAAGCTCGTCGAAGGCAGCGTCAAAACTGCCAGTGACTTTAGCTATTCAGCTCCTGCATATGCT
GGACCCAATTATAGAATTGTTGGAGATGCAGGCGCATTTATCGACCCATTTTTCTCCAGTGGTGTCCACCTTGCT
ATGACTTCAGCGCTTTCCGCTGCCGCGACCATTTGCGCCTCCATCCGTGGTAATTGCTCAGAAGCGCTAGCTGCT
TCCTGGCACACTCAGAGGGTGGCAACAAGCTATACCAGATTCCAAGTTGTCGTTCTCAGCGCATACAAGCAGATC
AGATCTCAGGCCGACGGTATTCTTTCCGACATTGACGAGGACAATTATGATCGTGCTTTCGCATTTCTTCGACCA
GTCATCCAAGGTGCTTCCGAGATGGGTGCTCGCCTTTCTGAAAACGAGCTTCAGAAGTCACTCGATTTTTGCGTC
AAGCTTTTTGATCCGACGACTCCAGAGGATCATCAGCGCGCTTCGCTTATGAATGGCCTTTCCTGTGACCTTCTT
GACGTCGGTACCCCTATCATTGATCCCAGTATCCTCGAGAAGACTTTGGATGGTGACTGCTTCATGCCATATGAC
GAGGATTCTGGTTCAGATGCAGAGAAGGCCGATGAAACCAAGATGGTGCTCCACAAAGTTAACGCGAGGCGGGTC
ATTCATTCTGAGTACGCCATAAACAACATGGAAATCGAGAACCTGGAAGGCTACGTCGTCCGCCTCGAAAGGTGG
AAGCTCGGACTCGTCAAAATGAGATCTCCCACCAAAAACTAA
Gene >AgabiH97|043200
ATGGCTACCTCTTCCTTACCTCCCAAGGTGCGCCGCACTCCCCGCCTTTCACCATTCTCTGCTTACCACTCTCCA
GCATACACAAGTCCTTGTTATTGGCGGGGGACCAGCCGGGTCCTACGCTGCCTCTGCCCTTGCGCGCGAAGGTAT
CAAAGTCACTCTCCTGGAAGCATCCAAATTCCCAAGGTGATCAGACTAGCCCGCAACCAAAGCACATGCGACTCA
CTTATAACAGGTATCATATCGGAGAGAGTTTGATCCCATCCGTACGCCACTATCTTAGGTTCATCGGTGCGGAAG
ACAAGCTAGCCAACCATGGGTTCGTACCCAAGGTCGGTGGCTATCCCAAATTGCGAGAAAATGCCGTTTGTAACG
TCGTTAATGTAGCCCGGCTCCGCTATCAAATTCAATCAGTTCAAACGTGAAGGATGTGGGTCATTTATTACCCGT
CTCCTGAACTGGACTGACGGTTTTCACAGATACTGATTTTGTGGCACTCGGCCACAACAATAACGCCTGGAACGT
TGTGAGTATTTCTAACAAAACTTAAAGTGAATCGCCGAAGCTGACCTGCGCCTAGGTACGATCTGAGTTTGATCA
GCTGTTGCTCAACCATGCCCGTACGTCGGGCGCCGCAGTATATGAACAAACCAAAGTAGATGCCATTCATTTTGA
CCCAATGAATCCGGAAAGACCTGTGTCTGTTTCATGGACGCATATTCCACCAGCAGGGCTGCCTTCGCCTCCGCC
ATCCCCGACGACATCCACATTCTCAAGATTCTTGCGGCGGTTCAGCAACGCTGAACAACCGTCGAATGTGGGCGG
GCCCATCCAGGGCACCACTGCCTTTACGCATGTTATTGATGCATCTGGCCGCGCAGGTCTTATGTCTGTACGATA
TCTGCACAACAGACGCTTCAACGCGTCGCTGAAGAATATCGCGATTTGGGGCTACTGGAACGGCGTCGAAAATTA
CGGCGAAGGAACAAGGCGGAGTGGAGCTCCCTGGTTTGAAGCGTTGACAGGTAAAGTTTTCTGCCTGTCATTCGT
TGTACGGTCGTATCCAACTGCCATCTTTTTCTAGACGAGTCGGGTTGGGCGTGGTTCATTCCCCTCCACAACGGT
ACAACTTCCATTGGTATTGTCGTCAATCAAAAGGTCTACAATGCCAAAGCGGACGCCCTCCCGTCTCCTCCATTC
GACGGCGCCCAAATTCCCAATCCGGATGCGTCCAGTCTCACTGCTCGCTACTTGTCCAATCTGAACTTCACTCCG
GGCGTTGTGCGCCTCATCGGGGAAGGGAAGCTCGTCGAAGGCAGCGTCAAAACTGCCAGTGACTTTAGCTATTCA
GCTCCTGCATATGCTGGACCCAATTATAGAATTGTTGGAGATGCAGGCGGTGAGAGCAACCACATACTGCACATC
CCATTACTAACGCTTCGTCCAACAGCATTTATCGACCCATTTTTCTCCAGTGGTGTCCACCTTGCTATGACTTCA
GCGCTTTCCGCTGCCGCGACCATTTGCGCCTCCATCCGTGGTAATTGCTCAGAAGCGCTAGCTGCTTCCTGGCAC
ACTCAGAGGGTGGCAACAAGCTATACCAGGTCAGTGACGCATCTCACGATAGAGCCTATCAGTACTCATGGAATC
AAGATTCCAAGTTGTCGTTCTCAGCGCATACAAGCAGATCAGATCTCAGGCCGACGGTATTCTTTCCGACATTGA
CGAGGACAATTATGATCGTGCTTTCGCATTTCTTCGACCAGGTCTGCGTCTCACGGGTTTATACCTATTCTTTCT
ATACTGAATTGCTCGCTCTGGTAGTCATCCAAGGTGCTTCCGAGATGGGTGCTCGCCTTTCTGAAAACGAGCTTC
AGAAGTCACTCGATTTTTGCGTCAAGCTTTTTGATCCGACGACTCCAGAGGATCATCAGCGCGCTTCGCTTATGA
ATGGCCTTTCCTGTGACCTTCTTGACGTCGGTACCCCTATCATTGATCCCAGTATCCTCGAGAAGACTTTGGATG
GTGACTGCTTCATGCCATATGACGAGGATTCTGGTTCAGATGCAGAGAAGGCCGATGAAACCAAGATGGTGCTCC
ACAAAGTTAACGCGAGGCGGGTCATTCATTCTGAGTACGCCATAAACAACATGGAAATCGAGAACCTGGAAGGCT
ACGTCGTCCGCCTCGAAAGGTGGAAGCTCGGACTCGTCAAAATGAGATCTCCCACCAAAAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail