Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043120
Gene name
Locationscaffold_2:1159945..1161367
Strand-
Gene length (bp)1422
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 7.7E-58 25 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 22 236 2.0E-37
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 6 244 9.0E-29
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 205 1.0E-26
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 22 236 2.0E-26
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 1 236 8.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 22 236 2.0E-37
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 6 244 9.0E-29
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 205 1.0E-26
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 22 236 2.0E-26
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 1 236 8.0E-24
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 25 236 1.0E-23
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 25 236 3.0E-23
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 22 277 8.0E-22
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 22 236 2.0E-21
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 22 277 2.0E-21
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 22 269 3.0E-21
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 22 236 1.0E-19
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 22 236 1.0E-19
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 41 236 6.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 41.12 22.26 59.99
Initials Initials knots 8.80 3.97 13.64
Pileal_Stipeal_center Stage I stipe center 25.56 13.39 37.72
Pileal_Stipeal_shell Stage I stipe shell 8.44 3.80 13.09
DIF_stipe_center Stage II stipe center 35.52 19.65 51.39
DIF_stipe_shell Stage II stipe shell 57.10 33.15 81.05
DIF_stipe_skin Stage II stipe skin 32.48 17.73 47.23
DIF_cap_skin Stage II cap skin 9.50 4.40 14.61
DIF_cap_tissue Stage II cap tissue 12.72 6.12 19.31
DIF_gill_tissue Stage II gill tissue 19.66 9.74 29.58
YFB_stipe_center Young fruiting body stipe center 63.61 35.43 91.79
YFB_stipe_shell Young fruiting body stipe shell 88.98 52.21 125.75
YFB_stipe_skin Young fruiting body stipe skin 88.98 53.04 124.91
YFB_cap_skin Young fruiting body cap skin 10.36 4.89 15.83
YFB_cap_tissue Young fruiting body cap tissue 15.39 7.36 23.41
YFB_gill_tissue Young fruiting body gill tissue 19.34 9.92 28.77
YFB_veil Young fruiting body veil 17.91 8.57 27.24

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.020523 yes
Casing YFB_stipe_center 0.180956 no
Casing YFB_stipe_shell 0.005671 yes
Casing YFB_stipe_skin 0.005671 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.001625 yes
Casing YFB_gill_tissue 0.014668 yes
Casing YFB_veil 0.010093 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.151247 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.761840 no
Casing DIF_stipe_shell 0.341679 no
Casing DIF_stipe_skin 0.563298 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.068270 no
DIF_gill_tissue YFB_cap_tissue 0.607384 no
DIF_gill_tissue YFB_gill_tissue 0.980603 no
DIF_gill_tissue YFB_veil 0.880166 no
YFB_stipe_center YFB_stipe_shell 0.315595 no
YFB_stipe_center YFB_stipe_skin 0.308255 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.999745 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.335694 no
YFB_cap_skin YFB_gill_tissue 0.066207 no
YFB_cap_skin YFB_veil 0.138143 no
YFB_cap_tissue YFB_gill_tissue 0.637637 no
YFB_cap_tissue YFB_veil 0.793229 no
YFB_gill_tissue YFB_veil 0.905266 no
Initials DIF_gill_tissue 0.020523 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.783612 no
Initials YFB_cap_tissue 0.145389 no
Initials YFB_gill_tissue 0.020790 yes
Initials YFB_veil 0.050908 no
Initials Pileal_Stipeal_center 0.001625 yes
Initials Pileal_Stipeal_shell 0.956240 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.914224 no
Initials DIF_cap_tissue 0.410629 no
Pileal_Stipeal_center DIF_gill_tissue 0.560248 no
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.004928 yes
Pileal_Stipeal_center YFB_cap_tissue 0.152189 no
Pileal_Stipeal_center YFB_gill_tissue 0.505049 no
Pileal_Stipeal_center YFB_veil 0.373742 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.368152 no
Pileal_Stipeal_center DIF_stipe_shell 0.002084 yes
Pileal_Stipeal_center DIF_stipe_skin 0.564308 no
Pileal_Stipeal_center DIF_cap_skin 0.002951 yes
Pileal_Stipeal_center DIF_cap_tissue 0.033444 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.014374 yes
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.713268 no
Pileal_Stipeal_shell YFB_cap_tissue 0.112109 no
Pileal_Stipeal_shell YFB_gill_tissue 0.015242 yes
Pileal_Stipeal_shell YFB_veil 0.032742 yes
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.857317 no
Pileal_Stipeal_shell DIF_cap_tissue 0.344582 no
DIF_stipe_center DIF_gill_tissue 0.071782 no
DIF_stipe_center YFB_stipe_center 0.044201 yes
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.007092 yes
DIF_stipe_center YFB_gill_tissue 0.052135 no
DIF_stipe_center YFB_veil 0.035537 yes
DIF_stipe_center DIF_stipe_shell 0.110389 no
DIF_stipe_center DIF_stipe_skin 0.868224 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.823668 no
DIF_stipe_shell YFB_stipe_shell 0.126467 no
DIF_stipe_shell YFB_stipe_skin 0.124412 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.046952 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.139408 no
DIF_stipe_skin YFB_stipe_center 0.014956 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.000613 yes
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.017226 yes
DIF_stipe_skin YFB_gill_tissue 0.109462 no
DIF_stipe_skin YFB_veil 0.073585 no
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.003765 yes
DIF_cap_skin DIF_gill_tissue 0.039165 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.898022 no
DIF_cap_skin YFB_cap_tissue 0.225814 no
DIF_cap_skin YFB_gill_tissue 0.040947 yes
DIF_cap_skin YFB_veil 0.086750 no
DIF_cap_skin DIF_cap_tissue 0.544574 no
DIF_cap_tissue DIF_gill_tissue 0.272348 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.699220 no
DIF_cap_tissue YFB_cap_tissue 0.723016 no
DIF_cap_tissue YFB_gill_tissue 0.278273 no
DIF_cap_tissue YFB_veil 0.435291 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043120
MNFLLVLSLIASLKFFIFIRGVTGHGFVHSVKVGGQDLPGWNPFVDSYANPQPERAIRKIKDDGPVPGDSSDMNC
GIGGDSATSMVADVAAGSQVTFEWEYWPADHQGPVSTYMASCDGDCTGFSANNAKWFKLDAGGYDPETKQWAADQ
LRANGNTWTSNIPSQLKPGQYLVRHEIVALHSQAPQFYPSCIQVRVTGSGTGTPSDSDLVSIPALYTGVKWPFIY
GDFGAFTIPGPPPVTFGGDNNGPPAPESYSSSSAPTATTESAPTASAPTTTNVESRGQQPSETSTSALPATTGQC
RLRRRFARSQEFIYGKALMTTDV*
Coding >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCATATGCAAAC
CCCCAGCCAGAACGTGCGATTCGAAAAATTAAGGATGACGGCCCTGTCCCGGGAGATAGCAGTGACATGAATTGT
GGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGGATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAA
TACTGGCCCGCGGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAACGGCAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATTTGGTGCGGCAC
GAGATTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCATCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA
Transcript >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCATATGCAAAC
CCCCAGCCAGAACGTGCGATTCGAAAAATTAAGGATGACGGCCCTGTCCCGGGAGATAGCAGTGACATGAATTGT
GGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGGATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAA
TACTGGCCCGCGGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAACGGCAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATTTGGTGCGGCAC
GAGATTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCATCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA
Gene >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCGTAAGCGATA
CCTCTATCGTTAATTCAACAACCTTTGCTGAAATTCAGATCCAGATATGCAAACCCCCAGCCAGAACGTGCGATT
CGAAAAATTAAGGATGACGGCCCTGGTGAGAATCTTTGTCCAGTGTCTTTTACTACATGTGTGTTTGACTTTAAG
CATTATTAGTCCCGGGAGATAGCAGTGACATGAATTGTGGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGG
ATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAATACGTGCGTAAATCAGCATCTTCATTATTCCGCGTAG
CTTACTGACTTCATGCTCACAGTGGCCCGCGGGTGAGCTAGTAATCTGATTTACACGCGATTTCTCATCTTTCCT
TTGATTCTTGAAGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAGTTGAGTTTCCCACTCGATGCGGCGATCTACTAGGAATTTTCATTAACCGGAAATCTCCAGACGG
CAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATGTGAGTGAAAATCTGTTACGTACAAT
CTTGGGCGGCTTCAGTACTCACTAATCCTCTAGTTGGTGCGGCACGAGATGTATGTGTTATTCTCGAAATCCAGA
GTCTTCTGGTCTTACAATGTCAATAATTAGTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCAT
GTAGGTATCTTCGTTTGTTTTCGCTTCGTACAACTTCTGATGGCTTGTAGCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail