Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043120
Gene name
Locationscaffold_2:1159945..1161367
Strand-
Gene length (bp)1422
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 7.7E-58 25 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 22 236 2.0E-37
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 6 244 9.0E-29
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 205 1.0E-26
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 22 236 2.0E-26
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 1 236 8.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 22 236 2.0E-37
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 6 244 9.0E-29
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 1 205 1.0E-26
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 22 236 2.0E-26
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 1 236 8.0E-24
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 25 236 1.0E-23
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 25 236 3.0E-23
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 22 277 8.0E-22
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 22 236 2.0E-21
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 22 277 2.0E-21
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 22 269 3.0E-21
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 22 236 1.0E-19
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 22 236 1.0E-19
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 41 236 6.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043120
MNFLLVLSLIASLKFFIFIRGVTGHGFVHSVKVGGQDLPGWNPFVDSYANPQPERAIRKIKDDGPVPGDSSDMNC
GIGGDSATSMVADVAAGSQVTFEWEYWPADHQGPVSTYMASCDGDCTGFSANNAKWFKLDAGGYDPETKQWAADQ
LRANGNTWTSNIPSQLKPGQYLVRHEIVALHSQAPQFYPSCIQVRVTGSGTGTPSDSDLVSIPALYTGVKWPFIY
GDFGAFTIPGPPPVTFGGDNNGPPAPESYSSSSAPTATTESAPTASAPTTTNVESRGQQPSETSTSALPATTGQC
RLRRRFARSQEFIYGKALMTTDV*
Coding >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCATATGCAAAC
CCCCAGCCAGAACGTGCGATTCGAAAAATTAAGGATGACGGCCCTGTCCCGGGAGATAGCAGTGACATGAATTGT
GGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGGATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAA
TACTGGCCCGCGGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAACGGCAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATTTGGTGCGGCAC
GAGATTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCATCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA
Transcript >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCATATGCAAAC
CCCCAGCCAGAACGTGCGATTCGAAAAATTAAGGATGACGGCCCTGTCCCGGGAGATAGCAGTGACATGAATTGT
GGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGGATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAA
TACTGGCCCGCGGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAACGGCAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATTTGGTGCGGCAC
GAGATTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCATCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA
Gene >AgabiH97|043120
ATGAATTTCTTATTAGTACTGTCTTTGATCGCTTCTTTGAAGTTCTTTATCTTTATACGGGGTGTAACTGGCCAT
GGCTTCGTCCATTCTGTAAAGGTCGGGGGACAGGACCTCCCGGGATGGAATCCCTTTGTCGATTCGTAAGCGATA
CCTCTATCGTTAATTCAACAACCTTTGCTGAAATTCAGATCCAGATATGCAAACCCCCAGCCAGAACGTGCGATT
CGAAAAATTAAGGATGACGGCCCTGGTGAGAATCTTTGTCCAGTGTCTTTTACTACATGTGTGTTTGACTTTAAG
CATTATTAGTCCCGGGAGATAGCAGTGACATGAATTGTGGCATCGGGGGTGACTCCGCAACATCAATGGTAGCGG
ATGTTGCTGCTGGTTCTCAAGTTACCTTCGAATGGGAATACGTGCGTAAATCAGCATCTTCATTATTCCGCGTAG
CTTACTGACTTCATGCTCACAGTGGCCCGCGGGTGAGCTAGTAATCTGATTTACACGCGATTTCTCATCTTTCCT
TTGATTCTTGAAGATCACCAAGGTCCCGTATCGACATATATGGCTTCCTGTGATGGTGATTGTACTGGTTTCTCA
GCAAATAATGCGAAATGGTTCAAGCTCGATGCCGGCGGTTATGATCCGGAGACCAAACAATGGGCTGCTGACCAG
CTCAGAGCCAGTTGAGTTTCCCACTCGATGCGGCGATCTACTAGGAATTTTCATTAACCGGAAATCTCCAGACGG
CAACACATGGACCTCAAATATACCATCTCAATTGAAACCTGGACAGTATGTGAGTGAAAATCTGTTACGTACAAT
CTTGGGCGGCTTCAGTACTCACTAATCCTCTAGTTGGTGCGGCACGAGATGTATGTGTTATTCTCGAAATCCAGA
GTCTTCTGGTCTTACAATGTCAATAATTAGTGTTGCTCTGCACTCCCAGGCACCCCAATTTTATCCTAGCTGCAT
GTAGGTATCTTCGTTTGTTTTCGCTTCGTACAACTTCTGATGGCTTGTAGCCAAGTCCGAGTGACTGGGTCTGGA
ACAGGAACGCCGTCCGATAGTGACCTTGTGTCCATTCCAGCGCTCTACACGGGCGTAAAGTGGCCCTTCATCTAT
GGAGATTTTGGAGCATTCACTATTCCCGGTCCTCCACCCGTTACTTTCGGTGGAGATAATAATGGACCTCCCGCA
CCTGAGTCATACTCTTCCTCCTCCGCCCCTACGGCCACAACCGAGTCAGCTCCCACCGCGTCCGCCCCTACGACC
ACAAATGTTGAGTCGCGCGGACAACAGCCCTCAGAGACGTCAACAAGTGCTCTTCCTGCCACCACTGGCCAATGC
CGTCTCAGAAGACGTTTCGCCAGAAGCCAAGAATTTATTTATGGCAAGGCCCTCATGACAACCGATGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail