Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|043010
Gene name
Locationscaffold_2:1128281..1129804
Strand+
Gene length (bp)1523
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.1E-39 59 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 57 380 5.0E-29
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 57 381 6.0E-29
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 48 380 4.0E-28
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 2 381 1.0E-27
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 48 380 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 57 380 5.0E-29
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 57 381 6.0E-29
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 48 380 4.0E-28
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 2 381 1.0E-27
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 48 380 4.0E-27
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 49 382 5.0E-27
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 46 381 6.0E-27
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 40 381 2.0E-26
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 40 381 1.0E-25
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 57 381 2.0E-25
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 57 381 3.0E-25
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 57 381 3.0E-25
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 57 381 5.0E-25
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 57 381 5.0E-25
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 48 381 6.0E-25
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 57 381 9.0E-25
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 49 382 9.0E-25
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 40 381 1.0E-24
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 48 381 1.0E-24
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 57 381 1.0E-24
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 57 381 1.0E-24
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 57 380 4.0E-24
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 49 382 6.0E-24
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 49 382 9.0E-24
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 37 381 2.0E-23
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 48 380 3.0E-23
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 57 381 6.0E-23
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 57 382 6.0E-23
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 48 381 1.0E-22
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 60 379 2.0E-22
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 33 381 2.0E-22
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 48 381 4.0E-22
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 46 380 4.0E-22
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 46 380 5.0E-22
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 45 381 7.0E-22
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 57 382 7.0E-22
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 46 380 7.0E-22
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 57 381 1.0E-21
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 48 381 2.0E-21
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 48 381 2.0E-21
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 48 381 4.0E-21
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 31 381 4.0E-21
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 47 310 6.0E-21
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 48 381 6.0E-21
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 57 382 7.0E-21
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 46 381 1.0E-20
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 57 381 2.0E-20
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 26 379 2.0E-20
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 48 381 2.0E-20
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 57 381 2.0E-20
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 23 382 3.0E-20
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 57 381 3.0E-20
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 43 326 3.0E-20
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 23 382 4.0E-20
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 23 382 4.0E-20
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 57 381 5.0E-20
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 57 381 8.0E-20
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 57 379 1.0E-19
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 57 381 1.0E-19
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 40 381 1.0E-19
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 23 382 2.0E-19
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 23 381 2.0E-19
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 57 379 2.0E-19
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 47 381 2.0E-19
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 46 381 2.0E-19
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 39 382 4.0E-19
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 46 313 4.0E-19
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 57 381 5.0E-19
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 57 381 6.0E-19
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 33 382 8.0E-19
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 57 382 9.0E-19
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 43 377 9.0E-19
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 17 381 9.0E-19
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 47 313 2.0E-18
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 57 379 3.0E-18
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 30 267 3.0E-18
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 57 381 5.0E-18
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 59 382 2.0E-17
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 40 381 2.0E-17
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 57 381 3.0E-17
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 49 381 8.0E-17
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 57 381 1.0E-16
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 32 267 1.0E-16
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 57 380 1.0E-16
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 57 381 2.0E-16
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 9 381 4.0E-16
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 57 267 9.0E-16
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 18 382 2.0E-15
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 36 304 2.0E-15
sp|P00795|CATD_PIG Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 57 381 3.0E-15
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 57 381 5.0E-15
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 57 267 6.0E-15
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 43 295 1.0E-14
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 18 267 2.0E-14
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 57 381 8.0E-14
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 47 382 9.0E-14
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 56 382 1.0E-13
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 55 379 1.0E-13
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 58 382 1.0E-13
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 2 381 2.0E-13
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 47 382 4.0E-13
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 47 382 5.0E-13
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 42 382 5.0E-13
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 42 382 5.0E-13
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 37 382 5.0E-13
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 37 382 5.0E-13
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 57 322 1.0E-12
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 64 380 3.0E-12
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 57 379 8.0E-12
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 57 379 8.0E-12
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 55 379 8.0E-12
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 32 306 1.0E-11
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 57 311 1.0E-11
sp|P42210|ASPR_HORVU Phytepsin OS=Hordeum vulgare PE=1 SV=1 57 267 3.0E-11
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 17 383 6.0E-11
sp|P46925|PLM2_PLAFA Plasmepsin-2 OS=Plasmodium falciparum PE=1 SV=1 47 382 6.0E-11
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 64 382 7.0E-11
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 46 382 9.0E-10
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 46 382 9.0E-10
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 46 382 9.0E-10
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 64 380 1.0E-09
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 58 382 1.0E-09
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 58 382 1.0E-09
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 58 382 2.0E-09
sp|W8W138|BACE_STRPU Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 58 379 2.0E-09
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 25 267 2.0E-09
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 14 379 6.0E-09
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 10 382 6.0E-09
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 10 382 7.0E-09
sp|A1DDK1|PEPA_NEOFI Aspartic protease pep1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pep1 PE=3 SV=1 72 380 7.0E-09
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 57 382 9.0E-09
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 57 382 9.0E-09
sp|P41748|PEPA_ASPFU Aspartic protease pep1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep1 PE=1 SV=2 72 380 1.0E-08
sp|B0Y1V8|PEPA_ASPFC Aspartic protease pep1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pep1 PE=3 SV=1 72 380 1.0E-08
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 7 381 1.0E-07
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 25 383 2.0E-07
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 60 379 2.0E-07
sp|P56819|BACE1_RAT Beta-secretase 1 OS=Rattus norvegicus GN=Bace1 PE=2 SV=1 1 379 3.0E-07
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 18 380 5.0E-07
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 25 383 7.0E-07
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 57 382 2.0E-06
sp|C5FZ57|Y7979_ARTOC Putative aspergillopepsin A-like aspartic endopeptidase MCYG_07979 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07979 PE=3 SV=1 57 380 3.0E-06
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 60 382 6.0E-06
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 60 382 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 14.11 7.07 21.15
Initials Initials knots 17.96 9.35 26.57
Pileal_Stipeal_center Stage I stipe center 10.35 4.99 15.70
Pileal_Stipeal_shell Stage I stipe shell 12.23 6.03 18.43
DIF_stipe_center Stage II stipe center 12.45 6.17 18.73
DIF_stipe_shell Stage II stipe shell 10.48 5.07 15.90
DIF_stipe_skin Stage II stipe skin 11.70 5.76 17.64
DIF_cap_skin Stage II cap skin 8.84 4.18 13.50
DIF_cap_tissue Stage II cap tissue 11.32 5.53 17.10
DIF_gill_tissue Stage II gill tissue 12.50 6.15 18.85
YFB_stipe_center Young fruiting body stipe center 12.06 5.94 18.18
YFB_stipe_shell Young fruiting body stipe shell 11.59 5.68 17.50
YFB_stipe_skin Young fruiting body stipe skin 10.55 5.08 16.01
YFB_cap_skin Young fruiting body cap skin 10.36 4.93 15.79
YFB_cap_tissue Young fruiting body cap tissue 8.50 4.00 13.00
YFB_gill_tissue Young fruiting body gill tissue 8.85 4.17 13.53
YFB_veil Young fruiting body veil 14.48 7.25 21.72

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.834856 no
Casing YFB_stipe_center 0.772780 no
Casing YFB_stipe_shell 0.696593 no
Casing YFB_stipe_skin 0.525018 no
Casing YFB_cap_skin 0.482111 no
Casing YFB_cap_tissue 0.172950 no
Casing YFB_gill_tissue 0.217538 no
Casing YFB_veil 0.969549 no
Casing Initials 0.588640 no
Casing Pileal_Stipeal_center 0.488298 no
Casing Pileal_Stipeal_shell 0.798950 no
Casing DIF_stipe_center 0.829317 no
Casing DIF_stipe_shell 0.508389 no
Casing DIF_stipe_skin 0.713268 no
Casing DIF_cap_skin 0.212366 no
Casing DIF_cap_tissue 0.645694 no
DIF_gill_tissue YFB_stipe_center 0.958803 no
DIF_gill_tissue YFB_stipe_shell 0.906765 no
DIF_gill_tissue YFB_stipe_skin 0.756006 no
DIF_gill_tissue YFB_cap_skin 0.719740 no
DIF_gill_tissue YFB_cap_tissue 0.342385 no
DIF_gill_tissue YFB_gill_tissue 0.414928 no
DIF_gill_tissue YFB_veil 0.788296 no
YFB_stipe_center YFB_stipe_shell 0.952636 no
YFB_stipe_center YFB_stipe_skin 0.816149 no
YFB_stipe_center YFB_cap_skin 0.783132 no
YFB_stipe_center YFB_cap_tissue 0.409922 no
YFB_stipe_center YFB_gill_tissue 0.485218 no
YFB_stipe_center YFB_veil 0.726547 no
YFB_stipe_shell YFB_stipe_skin 0.881514 no
YFB_stipe_shell YFB_cap_skin 0.853344 no
YFB_stipe_shell YFB_cap_tissue 0.481158 no
YFB_stipe_shell YFB_gill_tissue 0.558803 no
YFB_stipe_shell YFB_veil 0.648786 no
YFB_stipe_skin YFB_cap_skin 0.979661 no
YFB_stipe_skin YFB_cap_tissue 0.685591 no
YFB_stipe_skin YFB_gill_tissue 0.755861 no
YFB_stipe_skin YFB_veil 0.484539 no
YFB_cap_skin YFB_cap_tissue 0.712762 no
YFB_cap_skin YFB_gill_tissue 0.784361 no
YFB_cap_skin YFB_veil 0.445142 no
YFB_cap_tissue YFB_gill_tissue 0.956779 no
YFB_cap_tissue YFB_veil 0.148790 no
YFB_gill_tissue YFB_veil 0.194969 no
Initials DIF_gill_tissue 0.344316 no
Initials YFB_stipe_center 0.282996 no
Initials YFB_stipe_shell 0.225927 no
Initials YFB_stipe_skin 0.126612 no
Initials YFB_cap_skin 0.109929 no
Initials YFB_cap_tissue 0.016949 yes
Initials YFB_gill_tissue 0.031557 yes
Initials YFB_veil 0.650049 no
Initials Pileal_Stipeal_center 0.115817 no
Initials Pileal_Stipeal_shell 0.309002 no
Initials DIF_stipe_center 0.338690 no
Initials DIF_stipe_shell 0.125875 no
Initials DIF_stipe_skin 0.240070 no
Initials DIF_cap_skin 0.031323 yes
Initials DIF_cap_tissue 0.188653 no
Pileal_Stipeal_center DIF_gill_tissue 0.719173 no
Pileal_Stipeal_center YFB_stipe_center 0.784523 no
Pileal_Stipeal_center YFB_stipe_shell 0.853107 no
Pileal_Stipeal_center YFB_stipe_skin 0.978283 no
Pileal_Stipeal_center YFB_cap_skin 0.998426 no
Pileal_Stipeal_center YFB_cap_tissue 0.718454 no
Pileal_Stipeal_center YFB_gill_tissue 0.788232 no
Pileal_Stipeal_center YFB_veil 0.442612 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.756936 no
Pileal_Stipeal_center DIF_stipe_center 0.725159 no
Pileal_Stipeal_center DIF_stipe_shell 0.985137 no
Pileal_Stipeal_center DIF_stipe_skin 0.835784 no
Pileal_Stipeal_center DIF_cap_skin 0.780407 no
Pileal_Stipeal_center DIF_cap_tissue 0.887076 no
Pileal_Stipeal_shell DIF_gill_tissue 0.975341 no
Pileal_Stipeal_shell YFB_stipe_center 0.983591 no
Pileal_Stipeal_shell YFB_stipe_shell 0.935014 no
Pileal_Stipeal_shell YFB_stipe_skin 0.795629 no
Pileal_Stipeal_shell YFB_cap_skin 0.761644 no
Pileal_Stipeal_shell YFB_cap_tissue 0.379366 no
Pileal_Stipeal_shell YFB_gill_tissue 0.454917 no
Pileal_Stipeal_shell YFB_veil 0.753853 no
Pileal_Stipeal_shell DIF_stipe_center 0.979741 no
Pileal_Stipeal_shell DIF_stipe_shell 0.785863 no
Pileal_Stipeal_shell DIF_stipe_skin 0.947972 no
Pileal_Stipeal_shell DIF_cap_skin 0.445917 no
Pileal_Stipeal_shell DIF_cap_tissue 0.900591 no
DIF_stipe_center DIF_gill_tissue 0.994662 no
DIF_stipe_center YFB_stipe_center 0.962748 no
DIF_stipe_center YFB_stipe_shell 0.911582 no
DIF_stipe_center YFB_stipe_skin 0.765703 no
DIF_stipe_center YFB_cap_skin 0.728547 no
DIF_stipe_center YFB_cap_tissue 0.351080 no
DIF_stipe_center YFB_gill_tissue 0.422572 no
DIF_stipe_center YFB_veil 0.785902 no
DIF_stipe_center DIF_stipe_shell 0.756657 no
DIF_stipe_center DIF_stipe_skin 0.925559 no
DIF_stipe_center DIF_cap_skin 0.411911 no
DIF_stipe_center DIF_cap_tissue 0.875093 no
DIF_stipe_shell DIF_gill_tissue 0.745634 no
DIF_stipe_shell YFB_stipe_center 0.809985 no
DIF_stipe_shell YFB_stipe_shell 0.872579 no
DIF_stipe_shell YFB_stipe_skin 0.992840 no
DIF_stipe_shell YFB_cap_skin 0.986136 no
DIF_stipe_shell YFB_cap_tissue 0.695697 no
DIF_stipe_shell YFB_gill_tissue 0.767164 no
DIF_stipe_shell YFB_veil 0.467805 no
DIF_stipe_shell DIF_stipe_skin 0.855982 no
DIF_stipe_shell DIF_cap_skin 0.759503 no
DIF_stipe_shell DIF_cap_tissue 0.904820 no
DIF_stipe_skin DIF_gill_tissue 0.918333 no
DIF_stipe_skin YFB_stipe_center 0.964752 no
DIF_stipe_skin YFB_stipe_shell 0.988247 no
DIF_stipe_skin YFB_stipe_skin 0.865972 no
DIF_stipe_skin YFB_cap_skin 0.836030 no
DIF_stipe_skin YFB_cap_tissue 0.464638 no
DIF_stipe_skin YFB_gill_tissue 0.538457 no
DIF_stipe_skin YFB_veil 0.667662 no
DIF_stipe_skin DIF_cap_skin 0.531304 no
DIF_stipe_skin DIF_cap_tissue 0.960307 no
DIF_cap_skin DIF_gill_tissue 0.404055 no
DIF_cap_skin YFB_stipe_center 0.476371 no
DIF_cap_skin YFB_stipe_shell 0.554576 no
DIF_cap_skin YFB_stipe_skin 0.749444 no
DIF_cap_skin YFB_cap_skin 0.777018 no
DIF_cap_skin YFB_cap_tissue 0.957106 no
DIF_cap_skin YFB_gill_tissue 0.998096 no
DIF_cap_skin YFB_veil 0.188530 no
DIF_cap_skin DIF_cap_tissue 0.597253 no
DIF_cap_tissue DIF_gill_tissue 0.871126 no
DIF_cap_tissue YFB_stipe_center 0.923588 no
DIF_cap_tissue YFB_stipe_shell 0.972276 no
DIF_cap_tissue YFB_stipe_skin 0.916469 no
DIF_cap_tissue YFB_cap_skin 0.890234 no
DIF_cap_tissue YFB_cap_tissue 0.529827 no
DIF_cap_tissue YFB_gill_tissue 0.609240 no
DIF_cap_tissue YFB_veil 0.601321 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|043010
MLQSLGATLGVLSLAYAHAAPHMIRLQAVAPRKDLSLGRRALDPTTIPLVDHFLGTDLQWFGNITVGTPPQTLPM
VFDTGSSTLEFASTLCEACSHQVQFDPTKSSTFVDGGAIRTITFATGGGVDPVIGDNYQLTLRNGTDTVSIGGLS
APDVSLFLVIDQTPKFDPNPYSGIQGLGARAQGLFGSLVDQGLPALFSMYFTPKEVGNAEMTLGGIDDTKFIGSP
IFAPTSSSGSAWVLDSPSLSVNGKTNSLLSTPRNIIFDSGTSNILFSTNTTEAIYALISPDIKPNPKEPGAYGIA
CDTIPSLPAVIDMAFTSQDGTLFNLTIPSSELSVGPFADDPSICQTLINAFDGLDLVGGSLMKHWYTIWDLENRR
IGFAPAKL*
Coding >AgabiH97|043010
ATGCTTCAAAGTCTCGGGGCAACTTTAGGCGTTCTTTCCTTAGCCTACGCCCATGCTGCCCCACACATGATTCGT
TTACAAGCAGTAGCGCCTCGTAAAGATTTATCTTTGGGTAGACGGGCGTTGGATCCAACAACTATACCTCTGGTT
GACCATTTTTTGGGCACCGACTTGCAGTGGTTTGGAAACATAACAGTCGGAACACCGCCCCAAACATTACCGATG
GTATTTGACACAGGAAGCTCTACTCTCGAATTCGCCAGTACACTATGCGAGGCCTGCTCCCATCAGGTCCAATTT
GACCCAACAAAAAGCTCTACATTCGTTGATGGGGGGGCAATAAGGACCATCACGTTTGCAACTGGAGGTGGTGTT
GACCCAGTCATTGGGGACAATTATCAACTCACGCTACGAAACGGAACTGATACTGTGTCTATTGGGGGGTTATCT
GCTCCCGACGTCAGTCTTTTCCTCGTCATAGACCAAACTCCCAAGTTCGATCCGAATCCTTACAGCGGAATTCAA
GGCTTGGGTGCTCGTGCGCAAGGACTCTTTGGCAGTCTCGTGGACCAGGGCCTACCAGCATTGTTCAGCATGTAC
TTTACGCCTAAAGAGGTTGGCAACGCGGAGATGACCCTTGGAGGCATCGATGATACAAAATTCATCGGGTCGCCT
ATATTTGCTCCAACCTCATCCTCCGGATCTGCGTGGGTCCTGGACTCGCCGAGTCTGTCTGTGAACGGAAAGACG
AATTCATTATTGTCAACGCCACGAAATATCATTTTCGACAGTGGGACCAGCAACATTTTGTTTTCCACTAACACA
ACGGAGGCAATCTACGCCCTTATTTCCCCCGACATCAAACCGAATCCCAAAGAACCTGGGGCGTATGGGATTGCC
TGTGACACGATCCCGTCTCTCCCTGCTGTGATTGACATGGCGTTTACCTCACAGGATGGGACGCTTTTCAACCTG
ACCATCCCCAGCTCTGAACTGAGTGTTGGGCCCTTCGCTGACGACCCTTCGATATGTCAGACTCTCATCAATGCG
TTCGATGGTTTAGATCTCGTGGGCGGCAGTCTCATGAAACACTGGTACACTATATGGGACCTGGAAAATCGGAGG
ATCGGTTTCGCACCGGCGAAGTTGTAA
Transcript >AgabiH97|043010
ATGCTTCAAAGTCTCGGGGCAACTTTAGGCGTTCTTTCCTTAGCCTACGCCCATGCTGCCCCACACATGATTCGT
TTACAAGCAGTAGCGCCTCGTAAAGATTTATCTTTGGGTAGACGGGCGTTGGATCCAACAACTATACCTCTGGTT
GACCATTTTTTGGGCACCGACTTGCAGTGGTTTGGAAACATAACAGTCGGAACACCGCCCCAAACATTACCGATG
GTATTTGACACAGGAAGCTCTACTCTCGAATTCGCCAGTACACTATGCGAGGCCTGCTCCCATCAGGTCCAATTT
GACCCAACAAAAAGCTCTACATTCGTTGATGGGGGGGCAATAAGGACCATCACGTTTGCAACTGGAGGTGGTGTT
GACCCAGTCATTGGGGACAATTATCAACTCACGCTACGAAACGGAACTGATACTGTGTCTATTGGGGGGTTATCT
GCTCCCGACGTCAGTCTTTTCCTCGTCATAGACCAAACTCCCAAGTTCGATCCGAATCCTTACAGCGGAATTCAA
GGCTTGGGTGCTCGTGCGCAAGGACTCTTTGGCAGTCTCGTGGACCAGGGCCTACCAGCATTGTTCAGCATGTAC
TTTACGCCTAAAGAGGTTGGCAACGCGGAGATGACCCTTGGAGGCATCGATGATACAAAATTCATCGGGTCGCCT
ATATTTGCTCCAACCTCATCCTCCGGATCTGCGTGGGTCCTGGACTCGCCGAGTCTGTCTGTGAACGGAAAGACG
AATTCATTATTGTCAACGCCACGAAATATCATTTTCGACAGTGGGACCAGCAACATTTTGTTTTCCACTAACACA
ACGGAGGCAATCTACGCCCTTATTTCCCCCGACATCAAACCGAATCCCAAAGAACCTGGGGCGTATGGGATTGCC
TGTGACACGATCCCGTCTCTCCCTGCTGTGATTGACATGGCGTTTACCTCACAGGATGGGACGCTTTTCAACCTG
ACCATCCCCAGCTCTGAACTGAGTGTTGGGCCCTTCGCTGACGACCCTTCGATATGTCAGACTCTCATCAATGCG
TTCGATGGTTTAGATCTCGTGGGCGGCAGTCTCATGAAACACTGGTACACTATATGGGACCTGGAAAATCGGAGG
ATCGGTTTCGCACCGGCGAAGTTGTAA
Gene >AgabiH97|043010
ATGCTTCAAAGTCTCGGGGCAACTTTAGGCGTTCTTTCCTTAGCCTACGCCCATGCTGCCCCACACATGATTCGT
TTACAAGCAGTAGCGCCTCGTAAAGATTTATCTTTGGGTAGACGGGCGTTGGATCCAACAACTATACCTCTGGTT
GACCATTTTTTGGGCACCGACTTGCAGTGAGTTAGGTTTTGCGTATACATGTGCTATTAGTGATTTTGTGTCAAA
GGTGGTTTGGAAACATAACAGGTAATTGCCTCCTCCACAAATTTCAAATGATGACTGACCTCCGTCCGCAGTCGG
AACACCGCCCCAAACATTACCGGTGCGTATCTTTCTCTTATTCATCCGTTCCTAGCTCAACTTATCTAAATCTCA
GATGGTATTTGACACAGGAAGCTCTACTCTCGAATTCGCCAGTACACTATGCGAGGCCTGCTCCCATCAGGTCCA
ATTTGACCCAACAAAAAGCTCTACATTCGTTGATGGGGGGGCAATAAGGACCATCACGTTTGCAACTGGAGGTGG
TGTTGACCCAGTCATTGGGGACAATTATCAACTCACGCTACGAAACGGAACTGATACTGTGTCTATTGGGGGGTT
ATCTGCTCCCGACGTCAGTCTTTTCCTCGTCATAGACCAAACTCCCAAGTTCGATCCGAATCCTTACAGCGGAAT
TCAAGGCAAGTTTTGATTTGGTCCAGGTGAACAGAAAACTCTAACAATGTGCTAAGGCTTGGGTGCTCGTGCGCA
AGGACTCTTTGGCAGTCTCGTGGACCAGGGCCTACCAGGTAAGGACTCACTTTGTTATATCCTTGTCGTCCCGTT
CTAAGCACCCTGGGTGTTCCAGCATTGTTCAGCATGTACTTTACGCCTAAAGAGGTTGGCAACGCGGAGATGACC
CTTGGAGGCATCGATGATACAAAATTCATCGGTAGGTGACAAGTACTAAATCTGTACGATAAACCTTCCGCTAAT
AATAACACAGGGTCGCCTATATTTGCTCCAACCTCATCCTCCGGATCTGCGTGGGTCCTGGACTCGCCGAGTCTG
TCTGTGAACGGAAAGACGAATTCATTATTGTCAACGCCACGAAATATCATTTTCGACAGTGGGACCAGCAACATT
TTGTTTTCCACTAACACAACGGAGGTAAGCTTTATGTTTGTGCCGTTCTATCCATACGATGACGACTTTCTGTAT
AGGCAATCTACGCCCTTATTTCCCCCGACATCAAACCGAATCCCAAAGAACCTGGGGCGTATGGGATTGCCTGTG
ACACGATCCCGTCTCTCCCTGCTGTGATTGACATGGCGTTTACCTCACAGGATGGGACGCTTTTCAACCTGACCA
TCCCCAGCTCTGAACTGAGTGTTGGGCCCTTCGCTGACGACCCTTCGATATGTCAGACTCTCATCAATGCGTTCG
ATGGTTTAGATCTCGTGGGCGGCAGTCTCATGAAACACTGGTACACTATATGGGACCTGGAAAATCGGAGGATCG
GTTTCGCACCGGCGAAGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail