Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042970
Gene name
Locationscaffold_2:1120652..1121879
Strand-
Gene length (bp)1227
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01464 SLT Transglycosylase SLT domain 2.4E-12 174 262

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O31976|YOMI_BACSU SPBc2 prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) GN=yomI PE=3 SV=2 150 262 4.0E-07
sp|O64046|TMP_BPSPB Probable tape measure protein OS=Bacillus phage SPbeta GN=yomI PE=3 SV=1 150 262 4.0E-07
sp|O31608|YJBJ_BACSU Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) GN=yjbJ PE=3 SV=1 180 261 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042970
MRLPTALLTVFLTLALANASNPRDHSLGARHSRIASRMSPLEKKAPQKRCVRRDKGSKAKVTSTAKKEHTSVKAS
PSEATFSPPSKDDGKPSGNASSGGKILVASGKCGGSNAVAKTTKDNGPNGSIGFLNCGVDGSGWNPPPVHIDDVI
VKSLSEAVQSPSSPFHACKSYVPLFNQYGDKYGIPAIFLASFAMQESSCNPNTVGGGGEQGLMQITKDKCDGAPG
GDCKDPDFNIRTGAKFFADTLKSAGGNVLKAVAFYNGWYEGLTIDKATAARHSSCCRCQQNLDYLHQFFNGWCQN
IDAYDRKLGKYFNLDTCPT*
Coding >AgabiH97|042970
ATGAGGCTTCCAACGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGGCTCGAAGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGC
CCCAGCGAGGCGACTTTCAGCCCTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAA
ATACTCGTCGCTTCAGGCAAGTGTGGCGGTAGCAATGCAGTTGCTAAGACTACTAAGGACAATGGTCCTAATGGC
AGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCTCCACCTGTTCACATTGACGATGTCATC
GTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCACGCCTGCAAGTCTTATGTCCCGCTATTC
AATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCGTTTGCCATGCAGGAGAGCTCATGCAAT
CCCAACACTGTTGGTGGCGGTGGTGAACAAGGTCTCATGCAGATTACCAAGGACAAGTGCGATGGCGCACCTGGT
GGTGACTGCAAAGATCCCGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGAAGAGTGCAGGA
GGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGACAAAGCAACTGCTGCC
CGCCACTCTAGCTGCTGTCGCTGCCAACAGAACTTGGATTACCTTCACCAGTTTTTCAATGGTTGGTGCCAGAAT
ATTGATGCTTATGACCGAAAGCTAGGAAAGTATTTCAATCTTGACACTTGCCCGACCTAA
Transcript >AgabiH97|042970
ATGAGGCTTCCAACGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGGCTCGAAGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGC
CCCAGCGAGGCGACTTTCAGCCCTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAA
ATACTCGTCGCTTCAGGCAAGTGTGGCGGTAGCAATGCAGTTGCTAAGACTACTAAGGACAATGGTCCTAATGGC
AGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCTCCACCTGTTCACATTGACGATGTCATC
GTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCACGCCTGCAAGTCTTATGTCCCGCTATTC
AATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCGTTTGCCATGCAGGAGAGCTCATGCAAT
CCCAACACTGTTGGTGGCGGTGGTGAACAAGGTCTCATGCAGATTACCAAGGACAAGTGCGATGGCGCACCTGGT
GGTGACTGCAAAGATCCCGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGAAGAGTGCAGGA
GGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGACAAAGCAACTGCTGCC
CGCCACTCTAGCTGCTGTCGCTGCCAACAGAACTTGGATTACCTTCACCAGTTTTTCAATGGTTGGTGCCAGAAT
ATTGATGCTTATGACCGAAAGCTAGGAAAGTATTTCAATCTTGACACTTGCCCGACCTAA
Gene >AgabiH97|042970
ATGAGGCTTCCAACGGCCCTTCTCACTGTCTTCTTGACGCTCGCCCTTGCCAATGCCAGCAATCCTCGCGATCAC
TCCTTAGGTGCTCGTCACTCCCGTATTGCCTCCAGGATGTCTCCCCTCGAGAAAAAAGCTCCTCAGAAACGATGC
GTTCGACGTGATAAGGTGGATAACAACATTTCATAGTTCCTGCTTTGGCTTCTGACAAGATTTTGAAGGGCTCGA
AGGCGAAAGTCACTTCCACCGCAAAAAAAGAACACACTTCAGTTAAAGCAAGCCCCAGCGAGGCGACTTTCAGCC
CTCCTAGCAAGGACGATGGAAAGCCCTCTGGAAATGCTTCCAGCGGTGGTAAAATACTCGTCGCTTCAGGCAAGT
GTGGCGGTAGCAATGCAGTTGGTCAGCTTGTCCTTTACTCCCACCACTATCACCCTGAACCATGCTCTAGCTAAG
ACTACTAAGGACAATGGTCCTAATGGCAGCATTGGTTTCTTGAATTGTGGTGTTGATGGGTCGGGGTGGAATCCT
CCACCTGTTCACATTGACGATGTCATCGTCAAGAGTTTATCCGAGGCCGTTCAGTCGCCCAGTTCTCCATTTCAC
GCCTGCAAGTCTTATGTCCCGCTATTCAATCAGTATGGGGACAAGTACGGAATTCCAGCCATCTTCTTGGCTTCG
TTTGCCATGCAGGAGAGCTCATGCAATCCCAACACTGTTGGTGGCGGTGGTGAACAAGGTCTCATGCAGATTACC
AAGGACAAGTGCGATGGCGCACCTGGTGGTGACTGCAAAGATCCCGTGAATAACTGTCGCTCTTTCCCGCTCTTT
TCATACTCAATGATTCTGTTCTATGCCAGGACTTTAATATCCGTACTGGTGCTAAATTTTTTGCCGATACTTTGA
AGAGTGCAGGAGGGAATGTTTTGAAAGCCGTTGCTTTCTACAATGGCTGGTATGAAGGCTTGACTATCGTGCGTT
TATCAAGTCATTTGCACCCAACAGATAAATATTAATGTAACCGTAGGACAAAGCAACTGCTGCCCGCCACTCTAG
CTGCTGTCGCTGCCAACAGAACTTGGATTAGTGAGTCTTGCGTTATCTGGAGTAGGAAAAGGGCTAAAATATTAT
ACGCACAGCCTTCACCAGTTTTTCAATGGTTGGTGCCAGAATATTGATGCTTATGACCGAAAGCTAGGAAAGTAT
TTCAATCTTGACACTTGCCCGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail