Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042960
Gene name
Locationscaffold_2:1115010..1120356
Strand-
Gene length (bp)5346
Transcript length (bp)3879
Coding sequence length (bp)3879
Protein length (aa) 1293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08321 PPP5 PPP5 TPR repeat region 2.5E-26 157 254
PF00149 Metallophos Calcineurin-like phosphoesterase 7.4E-26 262 475
PF01805 Surp Surp module 1.1E-08 960 1001
PF04818 CID CID domain 4.7E-07 1044 1173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 45 543 3.0E-144
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 40 545 7.0E-133
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 45 545 3.0E-132
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 40 545 1.0E-131
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 41 540 6.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 45 543 3.0E-144
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 40 545 7.0E-133
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 45 545 3.0E-132
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 40 545 1.0E-131
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 41 540 6.0E-131
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 43 541 1.0E-108
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 193 540 3.0E-101
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 242 514 2.0E-53
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 216 526 1.0E-52
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 216 526 1.0E-52
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 216 526 1.0E-52
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 216 526 1.0E-52
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 216 526 2.0E-52
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 216 526 2.0E-52
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 242 540 7.0E-52
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 228 526 7.0E-52
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 242 512 9.0E-52
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 209 526 1.0E-51
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 216 526 2.0E-51
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 216 526 2.0E-51
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 216 526 2.0E-51
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 216 526 2.0E-51
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 216 526 3.0E-51
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 216 526 3.0E-51
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 215 526 1.0E-50
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 208 526 1.0E-50
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 238 512 1.0E-50
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 238 512 1.0E-50
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 238 512 2.0E-50
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 238 512 2.0E-50
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 238 512 2.0E-50
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 238 512 2.0E-50
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 238 512 2.0E-50
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 260 534 2.0E-50
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 246 512 2.0E-50
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 238 512 2.0E-50
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 260 534 2.0E-50
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 246 512 3.0E-50
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 263 526 3.0E-50
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 263 526 3.0E-50
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 242 514 3.0E-50
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 248 526 4.0E-50
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 238 512 5.0E-50
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 217 526 6.0E-50
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 218 526 7.0E-50
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 260 534 8.0E-50
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 238 512 9.0E-50
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 238 512 9.0E-50
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 249 526 1.0E-49
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 213 526 1.0E-49
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 260 534 2.0E-49
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 260 534 2.0E-49
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 258 528 2.0E-49
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 249 526 2.0E-49
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 238 539 2.0E-49
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 220 526 3.0E-49
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 246 512 3.0E-49
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 246 512 3.0E-49
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 221 512 3.0E-49
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 238 540 3.0E-49
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 238 540 3.0E-49
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 238 540 3.0E-49
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 238 540 3.0E-49
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 238 540 3.0E-49
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 238 540 3.0E-49
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 238 540 3.0E-49
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 238 540 3.0E-49
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 238 540 3.0E-49
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 260 534 3.0E-49
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 221 512 3.0E-49
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 221 512 3.0E-49
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 221 512 3.0E-49
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 221 512 3.0E-49
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 246 512 4.0E-49
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 238 540 4.0E-49
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 238 540 4.0E-49
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 263 526 4.0E-49
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 263 526 4.0E-49
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 238 512 5.0E-49
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 237 512 5.0E-49
sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 190 533 5.0E-49
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 258 528 6.0E-49
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 221 526 7.0E-49
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 221 526 7.0E-49
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 260 534 8.0E-49
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 260 534 8.0E-49
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 260 534 8.0E-49
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 260 534 8.0E-49
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 215 512 8.0E-49
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 215 536 9.0E-49
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 249 526 9.0E-49
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 260 534 1.0E-48
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 258 526 1.0E-48
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 258 526 1.0E-48
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 263 526 1.0E-48
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 260 532 1.0E-48
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 246 512 1.0E-48
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 237 512 1.0E-48
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 214 532 2.0E-48
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 220 524 2.0E-48
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 260 534 2.0E-48
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 246 519 3.0E-48
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 263 526 3.0E-48
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 258 526 3.0E-48
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 258 526 3.0E-48
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 258 526 3.0E-48
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 235 512 6.0E-48
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 258 526 7.0E-48
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 237 519 8.0E-48
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 225 512 8.0E-48
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 217 526 9.0E-48
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 215 533 1.0E-47
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 217 526 2.0E-47
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 220 524 2.0E-47
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 217 526 2.0E-47
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 217 526 2.0E-47
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 237 512 3.0E-47
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 258 526 3.0E-47
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 213 532 3.0E-47
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 221 526 4.0E-47
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 260 534 4.0E-47
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 217 526 4.0E-47
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 214 532 4.0E-47
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 238 523 5.0E-47
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 221 527 5.0E-47
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 237 519 6.0E-47
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 238 512 6.0E-47
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 238 512 7.0E-47
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 238 512 9.0E-47
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 221 526 1.0E-46
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 225 512 1.0E-46
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 246 514 2.0E-46
sp|O35655|PPE1_MOUSE Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 190 579 2.0E-46
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 229 511 2.0E-46
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 235 513 2.0E-46
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 238 523 4.0E-46
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 214 528 1.0E-45
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 224 512 2.0E-45
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 224 548 3.0E-45
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 246 511 3.0E-45
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 235 512 5.0E-45
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 214 532 6.0E-45
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 213 546 1.0E-44
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 260 533 3.0E-44
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 221 527 5.0E-44
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 263 524 9.0E-44
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 260 533 1.0E-43
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 249 532 1.0E-43
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 249 532 1.0E-43
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 237 532 2.0E-43
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 237 532 2.0E-43
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 267 514 2.0E-43
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 249 532 2.0E-43
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 249 532 2.0E-43
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 237 532 2.0E-43
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 260 531 3.0E-43
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 227 526 7.0E-43
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 260 534 1.0E-42
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 222 526 4.0E-42
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 235 511 4.0E-42
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 252 511 6.0E-42
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 244 532 6.0E-42
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 246 519 8.0E-42
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 263 524 1.0E-41
sp|O15042|SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens GN=U2SURP PE=1 SV=2 967 1284 3.0E-41
sp|Q5R7X2|SR140_PONAB U2 snRNP-associated SURP motif-containing protein OS=Pongo abelii GN=U2SURP PE=2 SV=1 967 1284 3.0E-41
sp|Q6NV83|SR140_MOUSE U2 snRNP-associated SURP motif-containing protein OS=Mus musculus GN=U2surp PE=1 SV=3 967 1284 3.0E-41
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 236 519 4.0E-41
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 244 532 6.0E-41
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 242 536 6.0E-41
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 248 532 6.0E-41
sp|Q9FN02|PPP7_ARATH Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 230 532 6.0E-41
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 244 532 1.0E-40
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 197 532 1.0E-40
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 224 534 1.0E-40
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 242 528 1.0E-40
sp|Q8SRZ0|PP1L_ENCCU Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 211 506 1.0E-40
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 244 532 4.0E-40
sp|O14829|PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 197 579 4.0E-40
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 249 535 5.0E-40
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 249 535 5.0E-40
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 249 535 5.0E-40
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 225 511 6.0E-40
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 222 520 1.0E-39
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 222 520 4.0E-39
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 221 526 4.0E-39
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 222 520 5.0E-39
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 246 529 1.0E-37
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 215 532 1.0E-36
sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 202 522 2.0E-36
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 235 511 7.0E-36
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 235 511 2.0E-35
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 249 526 4.0E-34
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 246 511 1.0E-33
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 263 524 9.0E-33
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 246 511 1.0E-32
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 246 511 1.0E-31
sp|P48460|YY06_CAEEL Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 251 516 1.0E-28
sp|Q9LNG5|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 229 673 2.0E-26
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 189 417 4.0E-24
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 193 417 4.0E-23
sp|Q9LEV0|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 211 508 8.0E-22
sp|Q5R7X2|SR140_PONAB U2 snRNP-associated SURP motif-containing protein OS=Pongo abelii GN=U2SURP PE=2 SV=1 633 849 2.0E-21
sp|Q6NV83|SR140_MOUSE U2 snRNP-associated SURP motif-containing protein OS=Mus musculus GN=U2surp PE=1 SV=3 633 849 2.0E-21
sp|O15042|SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens GN=U2SURP PE=1 SV=2 633 849 3.0E-21
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 41 177 2.0E-20
sp|Q10200|YBY1_SCHPO Uncharacterized protein C11C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC11C11.01 PE=1 SV=2 1021 1257 1.0E-15
sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens GN=SGTA PE=1 SV=1 40 155 7.0E-15
sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus GN=Sgta PE=1 SV=1 40 155 1.0E-14
sp|Q32LM2|SGTA_BOVIN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Bos taurus GN=SGTA PE=2 SV=1 12 155 1.0E-14
sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Mus musculus GN=Sgta PE=1 SV=2 40 155 1.0E-14
sp|P34350|YK84_CAEEL Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 242 512 6.0E-14
sp|P0CT30|SGT2_USTMA Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10205 PE=3 SV=1 41 162 2.0E-13
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 51 166 3.0E-13
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 51 161 5.0E-13
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 51 161 5.0E-13
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 428 525 9.0E-13
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 430 524 2.0E-12
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 15 162 2.0E-12
sp|F4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial OS=Arabidopsis thaliana GN=OM64 PE=1 SV=1 36 152 6.0E-12
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 42 161 8.0E-12
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 42 161 1.0E-11
sp|P23231|TOM70_NEUCR Mitochondrial import receptor subunit tom70 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom70 PE=2 SV=3 41 177 1.0E-11
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 42 161 1.0E-11
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 31 177 3.0E-11
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 38 162 3.0E-11
sp|O13797|SGT2_SCHPO Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgt2 PE=3 SV=1 43 164 1.0E-10
sp|Q9LVH5|OE64C_ARATH Outer envelope protein 64, chloroplastic OS=Arabidopsis thaliana GN=OEP64 PE=1 SV=1 18 149 1.0E-10
sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 47 166 2.0E-10
sp|Q12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT2 PE=1 SV=1 42 179 4.0E-10
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 31 177 7.0E-10
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 31 177 2.0E-09
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 51 205 2.0E-09
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 47 162 3.0E-09
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 31 181 3.0E-09
sp|O16259|STIP1_CAEEL Stress-induced-phosphoprotein 1 OS=Caenorhabditis elegans GN=sti-1 PE=1 SV=1 51 153 4.0E-09
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 37 166 4.0E-09
sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 32 163 5.0E-09
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 43 245 5.0E-09
sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 47 166 1.0E-08
sp|Q5U2X2|SPAG1_RAT Sperm-associated antigen 1 OS=Rattus norvegicus GN=Spag1 PE=1 SV=1 13 166 1.0E-08
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 18 185 1.0E-08
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor subunit tom70 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom70 PE=1 SV=1 41 137 2.0E-08
sp|Q9LNB6|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1 OS=Arabidopsis thaliana GN=HOP1 PE=2 SV=1 47 165 2.0E-08
sp|Q8ILC1|STI1L_PLAF7 STI1-like protein OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0324 PE=3 SV=1 43 149 3.0E-08
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 43 148 3.0E-08
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 47 174 3.0E-08
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 39 152 5.0E-08
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 43 155 5.0E-08
sp|Q9H892|TTC12_HUMAN Tetratricopeptide repeat protein 12 OS=Homo sapiens GN=TTC12 PE=1 SV=2 42 150 5.0E-08
sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 47 152 5.0E-08
sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1 46 163 6.0E-08
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 43 155 6.0E-08
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 45 155 7.0E-08
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 43 148 7.0E-08
sp|Q80ZK9|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1 49 127 7.0E-08
sp|Q863A4|DYXC1_PONPY Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pongo pygmaeus GN=DYX1C1 PE=3 SV=1 34 168 8.0E-08
sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 51 122 9.0E-08
sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 51 122 1.0E-07
sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 51 122 1.0E-07
sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 51 122 1.0E-07
sp|Q5VJS5|DYXC1_RAT Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Rattus norvegicus GN=Dyx1c1 PE=1 SV=1 34 168 1.0E-07
sp|Q863A7|DYXC1_PANTR Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan troglodytes GN=DYX1C1 PE=3 SV=1 42 168 1.0E-07
sp|Q8WXU2|DYXC1_HUMAN Dyslexia susceptibility 1 candidate gene 1 protein OS=Homo sapiens GN=DYX1C1 PE=1 SV=2 42 168 1.0E-07
sp|Q863A5|DYXC1_GORGO Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Gorilla gorilla gorilla GN=DYX1C1 PE=3 SV=1 42 168 1.0E-07
sp|Q863A6|DYXC1_PANPA Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Pan paniscus GN=DYX1C1 PE=3 SV=1 42 168 1.0E-07
sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 51 122 1.0E-07
sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 51 122 1.0E-07
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 50 170 1.0E-07
sp|Q5ZKQ3|RPAP3_CHICK RNA polymerase II-associated protein 3 OS=Gallus gallus GN=RPAP3 PE=2 SV=1 44 180 2.0E-07
sp|Q8N5D0|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2 49 127 2.0E-07
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 43 148 2.0E-07
sp|Q9MUK5|TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum GN=TOC64 PE=1 SV=1 51 149 2.0E-07
sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 35 215 3.0E-07
sp|Q95LY5|TTC12_MACFA Tetratricopeptide repeat protein 12 (Fragment) OS=Macaca fascicularis GN=TTC12 PE=2 SV=1 42 150 3.0E-07
sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=1 SV=1 43 148 4.0E-07
sp|Q54VG4|SGT_DICDI Small glutamine-rich tetratricopeptide repeat-containing protein OS=Dictyostelium discoideum GN=sgt PE=1 SV=1 42 152 4.0E-07
sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 35 172 5.0E-07
sp|Q8R368|DYXC1_MOUSE Dyslexia susceptibility 1 candidate gene 1 protein homolog OS=Mus musculus GN=Dyx1c1 PE=1 SV=2 42 165 6.0E-07
sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2 40 155 6.0E-07
sp|Q43468|HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max GN=HOP1 PE=1 SV=2 47 164 6.0E-07
sp|Q9STH1|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana GN=HOP3 PE=2 SV=1 47 152 8.0E-07
sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 35 172 8.0E-07
sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1 40 155 9.0E-07
sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 86 189 1.0E-06
sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 42 159 1.0E-06
sp|Q9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 OS=Homo sapiens GN=RPAP3 PE=1 SV=2 40 169 2.0E-06
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 718 848 2.0E-06
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 47 124 2.0E-06
sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=1 SV=1 46 196 2.0E-06
sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 54 160 3.0E-06
sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 37 172 3.0E-06
sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 30 166 3.0E-06
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 427 516 3.0E-06
sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 39 152 3.0E-06
sp|Q68FQ7|RPAP3_RAT RNA polymerase II-associated protein 3 OS=Rattus norvegicus GN=Rpap3 PE=1 SV=1 55 169 4.0E-06
sp|O95801|TTC4_HUMAN Tetratricopeptide repeat protein 4 OS=Homo sapiens GN=TTC4 PE=1 SV=3 38 163 4.0E-06
sp|E7EU14|PP5D1_HUMAN Protein PPP5D1 OS=Homo sapiens GN=PPP5D1 PE=2 SV=2 126 237 5.0E-06
sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus GN=TTC4 PE=2 SV=2 23 193 5.0E-06
sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 86 189 8.0E-06
sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 51 153 9.0E-06
sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 47 156 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042960
MSNLSSSATSSPTLVESTPHSSVPSPQMNSLSLTDPITISDEDKKEAARIKTEANKAFTSHNYTVAAKLYSDAIE
KNHSDPTLWCNRAYTRMKLEEFGYALNDTTQAISLDPRYVKAYYRRATCYLQTLRPQFAVVDFKKILAIEPKNET
VRQQMVSTQKLIRRTEFEKAIEMEEEKDAVARCLEIIAEGGCEMDKAYTGPKLPYDDGKFQITIEFIRSMIQWFK
DGKTLPKRYVWEIALGAHAAFASEESLVELSIPDDITVDVIGDVHGQFYDVLHLFSLTGEPGEKHYLLMNGDLVD
RGSWSMEVILVAFAYKWLYPKYMFINRGNHEAKDMNRTYGFEGEAKQKHGDQSYKLFAHIFTTLPLATLVSGTKP
PTTKEAAGAILSPDGFKRYFVVHGGLFSQDQVTLDDVRKIQRVGRQPGTEGLMCELLWTDPQEAPGRGPSKRGVG
ISFGPDVTKRWCELNSVSGVIRSHEVRQDGYQVEHDGLCTTVFSAPNYVDQAGNKGAFIRIDAAGKQEFFQFEAK
PHPPMKPMAYVQGGLGNLMMITRHQYIISEPLDLRSSTPDHFLQAFKVMDKTKSKLAAFFDDDEDSSFPQKHVDE
AKISQYTSGTVRKSRREKEQEAAEAKKREEEASAAKAYAEFLDAFQGDDAAGKKKSTFVRAGSDGAEYNLPRAGE
VNSSNTRTSGIERSISPAMSMPKPKGKRAMDAFLEEIKRDQAEREAKYAKQSQSHGRSVTALAAYEGQSGSKDRG
DPQTSNVFVANLPPHVTEESLGNFFARAGPVGSVKIMWPRSDATVGPGADMTASRRSGKAGLSGFVSFMKRHDAE
EALREFDGYDWGGSVLRVGWSKAVPIAAKPKYVAASYYREHGTSRSRSRERPRSRSQDKYYRRSHRSRSQSYDRD
RNRSPSQSRRRSRSRSRHRHYSSRSRSPRRRYSRSPLSRAHTEEEEAVTDTFIRAVASEVKGQDLKYEEVLRERE
RNNPKYAFLIHRNHRRHAFYRGLVESDRILKPEFDDDGYNSIYSSDSAEESERERGRRSKLGKLARKRFEAMLRG
MSGKRGEIARCMAFSLEHAEAAHEIVDVIVASLLVDSTAVPRKVARLHLICDILHNSAATVPSAWKFRQEFQSRL
GIVFDHLANIYHSFPGRMTAETFKKQIIAIVEIWEDWIVFPPEVTAELRQRLEGAAVPSETKVEDKEEKVEEQKS
SFSSRFKQSSFKLATDTSSADENVMDDMDGEPLDNVDGEPVDDVDGEPVEDIDGAPVDDVDGEPMEDIDGMPMDD
DIDGEPADADMASVADV*
Coding >AgabiH97|042960
ATGTCTAATTTATCCTCATCGGCCACATCATCTCCCACCTTGGTCGAGTCGACGCCGCACTCATCAGTCCCCTCG
CCTCAGATGAACAGCCTTTCCCTGACAGACCCTATCACCATTTCCGATGAAGATAAGAAAGAGGCTGCACGGATA
AAAACTGAAGCCAACAAAGCATTTACAAGCCACAACTATACCGTCGCAGCCAAACTCTACTCGGATGCGATCGAG
AAAAATCATAGTGACCCTACACTATGGTGTAATCGTGCTTATACCAGGATGAAATTAGAGGAATTTGGGTATGCT
TTGAACGATACAACGCAAGCTATCAGTCTTGACCCCCGATACGTGAAGGCTTATTACCGTCGGGCGACATGTTAT
CTACAGACTCTCAGACCTCAGTTTGCGGTCGTAGACTTCAAGAAAATTCTGGCCATTGAGCCCAAGAATGAGACA
GTGCGACAGCAAATGGTCTCGACGCAGAAACTTATAAGGAGAACTGAATTTGAGAAGGCGATCGAAATGGAAGAA
GAAAAAGATGCTGTGGCCAGATGCTTAGAAATTATTGCCGAAGGTGGCTGCGAAATGGATAAAGCGTATACGGGT
CCCAAATTACCTTATGACGACGGAAAATTCCAGATCACCATCGAGTTCATTCGTAGCATGATCCAGTGGTTCAAA
GACGGAAAGACGTTGCCGAAACGTTATGTTTGGGAAATCGCATTGGGTGCTCATGCCGCTTTCGCTTCTGAAGAA
AGTTTGGTCGAATTATCCATCCCTGACGATATCACAGTTGATGTCATCGGAGATGTTCATGGTCAATTCTATGAT
GTGCTACATCTGTTCTCGCTTACTGGGGAGCCTGGTGAGAAGCATTATTTGCTTATGAATGGTGATCTCGTGGAT
AGAGGTTCATGGTCCATGGAGGTCATTCTGGTTGCTTTTGCCTACAAATGGTTATATCCGAAGTATATGTTTATC
AACCGTGGTAACCATGAAGCAAAAGATATGAATCGGACATACGGGTTCGAAGGCGAAGCCAAGCAAAAACACGGT
GACCAGAGTTACAAGTTATTTGCGCACATATTCACCACCTTGCCTTTGGCAACTCTGGTGAGCGGTACCAAGCCT
CCAACGACCAAGGAAGCCGCCGGTGCCATACTCTCACCTGATGGATTCAAACGGTATTTCGTTGTTCATGGTGGT
TTGTTCAGTCAAGATCAGGTAACTTTGGATGATGTCCGAAAAATTCAACGGGTTGGCCGTCAGCCTGGTACTGAA
GGATTGATGTGCGAGCTATTATGGACCGACCCTCAAGAAGCACCAGGACGTGGACCAAGTAAACGGGGTGTTGGT
ATTTCATTTGGACCTGACGTGACAAAACGATGGTGTGAACTGAATAGTGTTTCTGGCGTCATAAGAAGTCATGAG
GTTCGACAAGATGGCTACCAGGTAGAACATGATGGCCTTTGCACCACGGTGTTCTCCGCGCCGAATTATGTTGAT
CAAGCCGGAAATAAAGGCGCTTTTATCCGCATTGATGCTGCTGGCAAACAGGAATTTTTCCAGTTTGAGGCCAAG
CCTCATCCCCCTATGAAACCGATGGCTTATGTTCAAGGCGGTCTCGGCAACCTTATGATGATCACTCGCCATCAA
TATATCATTTCTGAGCCTCTCGACCTTCGTTCTTCAACGCCCGACCATTTCTTACAAGCATTCAAGGTCATGGAC
AAAACCAAGTCAAAGCTAGCAGCGTTTTTTGATGATGACGAGGACTCTTCCTTCCCACAAAAACACGTTGACGAG
GCGAAAATCTCGCAGTATACTTCGGGCACTGTTCGTAAATCGAGGCGCGAAAAAGAGCAAGAGGCTGCTGAAGCC
AAGAAACGAGAAGAGGAAGCTTCCGCGGCTAAAGCATATGCCGAATTCTTGGATGCATTCCAAGGAGACGATGCG
GCTGGAAAGAAGAAATCAACGTTTGTTAGAGCGGGCTCGGATGGAGCAGAATACAACCTGCCTAGGGCTGGTGAG
GTGAACTCTTCAAACACAAGAACGTCTGGTATAGAAAGGTCGATATCACCTGCAATGAGTATGCCGAAGCCGAAG
GGTAAGAGGGCTATGGACGCATTTTTGGAGGAAATTAAAAGGGACCAAGCAGAGAGGGAAGCCAAATATGCGAAG
CAATCCCAAAGTCATGGTCGTTCAGTAACGGCACTTGCAGCCTACGAGGGTCAGAGTGGTAGTAAAGATCGCGGC
GATCCCCAGACTTCGAATGTCTTTGTTGCTAATCTACCCCCGCATGTCACGGAAGAGTCTCTGGGCAATTTCTTT
GCCCGAGCGGGACCGGTGGGCTCTGTCAAAATCATGTGGCCCAGATCCGACGCTACGGTAGGTCCTGGTGCAGAT
ATGACCGCGTCTCGAAGGAGCGGCAAGGCGGGGTTAAGCGGTTTTGTTTCTTTTATGAAACGCCATGATGCTGAA
GAGGCGCTACGCGAGTTTGATGGATACGATTGGGGAGGTTCTGTCTTACGAGTTGGATGGAGTAAAGCTGTTCCC
ATTGCAGCGAAACCGAAATATGTCGCGGCTTCATACTATCGAGAACATGGGACAAGCCGGAGCCGTTCCAGGGAA
CGTCCGCGGTCCCGTTCACAAGACAAATATTACAGACGGTCGCATCGCTCTCGCAGCCAATCTTACGACAGAGAC
AGGAACAGAAGCCCATCCCAGTCTCGTCGTAGATCTCGTAGTCGGTCGCGGCATCGACACTATTCCTCTCGCAGT
CGTTCACCACGACGACGTTATTCCCGCAGCCCACTCAGTAGAGCTCATACTGAAGAGGAAGAGGCAGTCACTGAT
ACTTTCATTCGAGCCGTTGCTTCAGAGGTAAAAGGCCAAGATTTGAAGTACGAGGAAGTACTTAGGGAGCGCGAA
CGCAACAACCCCAAATACGCATTCTTGATTCATAGAAATCACCGGCGACATGCATTTTATCGTGGTTTGGTGGAG
TCTGACCGTATTCTAAAGCCGGAATTCGATGATGATGGCTACAATTCTATCTATTCATCTGATTCCGCCGAGGAA
TCAGAAAGAGAACGCGGTCGTAGAAGCAAACTAGGAAAATTGGCGAGGAAACGATTCGAGGCGATGCTCCGTGGG
ATGTCAGGCAAGCGAGGCGAGATCGCAAGATGCATGGCATTCAGCCTCGAACACGCTGAAGCAGCACATGAGATT
GTAGACGTCATTGTTGCCTCCCTCCTAGTGGATAGCACTGCCGTACCAAGAAAAGTCGCTCGATTGCACCTTATT
TGTGACATTCTCCACAATTCAGCCGCAACCGTACCAAGTGCTTGGAAGTTCAGGCAGGAATTTCAGTCCCGGCTC
GGCATTGTGTTTGATCATCTTGCAAACATTTATCATTCCTTCCCTGGTCGCATGACAGCAGAGACTTTCAAGAAG
CAAATTATCGCTATCGTTGAGATCTGGGAGGACTGGATTGTATTTCCTCCGGAGGTGACAGCTGAGCTACGCCAA
CGACTCGAAGGTGCCGCGGTGCCATCCGAAACGAAGGTAGAGGACAAGGAAGAAAAAGTGGAAGAACAGAAGAGC
TCATTCAGTTCTCGGTTCAAGCAAAGCTCGTTCAAGCTTGCCACCGATACTTCGTCCGCTGATGAGAATGTCATG
GACGATATGGATGGTGAACCTCTGGACAACGTAGATGGAGAACCAGTGGATGACGTAGATGGAGAACCAGTGGAA
GATATAGACGGAGCACCTGTGGACGATGTAGATGGGGAACCTATGGAGGACATTGACGGCATGCCTATGGATGAT
GATATCGACGGTGAACCTGCAGATGCGGACATGGCTTCTGTAGCTGATGTTTAA
Transcript >AgabiH97|042960
ATGTCTAATTTATCCTCATCGGCCACATCATCTCCCACCTTGGTCGAGTCGACGCCGCACTCATCAGTCCCCTCG
CCTCAGATGAACAGCCTTTCCCTGACAGACCCTATCACCATTTCCGATGAAGATAAGAAAGAGGCTGCACGGATA
AAAACTGAAGCCAACAAAGCATTTACAAGCCACAACTATACCGTCGCAGCCAAACTCTACTCGGATGCGATCGAG
AAAAATCATAGTGACCCTACACTATGGTGTAATCGTGCTTATACCAGGATGAAATTAGAGGAATTTGGGTATGCT
TTGAACGATACAACGCAAGCTATCAGTCTTGACCCCCGATACGTGAAGGCTTATTACCGTCGGGCGACATGTTAT
CTACAGACTCTCAGACCTCAGTTTGCGGTCGTAGACTTCAAGAAAATTCTGGCCATTGAGCCCAAGAATGAGACA
GTGCGACAGCAAATGGTCTCGACGCAGAAACTTATAAGGAGAACTGAATTTGAGAAGGCGATCGAAATGGAAGAA
GAAAAAGATGCTGTGGCCAGATGCTTAGAAATTATTGCCGAAGGTGGCTGCGAAATGGATAAAGCGTATACGGGT
CCCAAATTACCTTATGACGACGGAAAATTCCAGATCACCATCGAGTTCATTCGTAGCATGATCCAGTGGTTCAAA
GACGGAAAGACGTTGCCGAAACGTTATGTTTGGGAAATCGCATTGGGTGCTCATGCCGCTTTCGCTTCTGAAGAA
AGTTTGGTCGAATTATCCATCCCTGACGATATCACAGTTGATGTCATCGGAGATGTTCATGGTCAATTCTATGAT
GTGCTACATCTGTTCTCGCTTACTGGGGAGCCTGGTGAGAAGCATTATTTGCTTATGAATGGTGATCTCGTGGAT
AGAGGTTCATGGTCCATGGAGGTCATTCTGGTTGCTTTTGCCTACAAATGGTTATATCCGAAGTATATGTTTATC
AACCGTGGTAACCATGAAGCAAAAGATATGAATCGGACATACGGGTTCGAAGGCGAAGCCAAGCAAAAACACGGT
GACCAGAGTTACAAGTTATTTGCGCACATATTCACCACCTTGCCTTTGGCAACTCTGGTGAGCGGTACCAAGCCT
CCAACGACCAAGGAAGCCGCCGGTGCCATACTCTCACCTGATGGATTCAAACGGTATTTCGTTGTTCATGGTGGT
TTGTTCAGTCAAGATCAGGTAACTTTGGATGATGTCCGAAAAATTCAACGGGTTGGCCGTCAGCCTGGTACTGAA
GGATTGATGTGCGAGCTATTATGGACCGACCCTCAAGAAGCACCAGGACGTGGACCAAGTAAACGGGGTGTTGGT
ATTTCATTTGGACCTGACGTGACAAAACGATGGTGTGAACTGAATAGTGTTTCTGGCGTCATAAGAAGTCATGAG
GTTCGACAAGATGGCTACCAGGTAGAACATGATGGCCTTTGCACCACGGTGTTCTCCGCGCCGAATTATGTTGAT
CAAGCCGGAAATAAAGGCGCTTTTATCCGCATTGATGCTGCTGGCAAACAGGAATTTTTCCAGTTTGAGGCCAAG
CCTCATCCCCCTATGAAACCGATGGCTTATGTTCAAGGCGGTCTCGGCAACCTTATGATGATCACTCGCCATCAA
TATATCATTTCTGAGCCTCTCGACCTTCGTTCTTCAACGCCCGACCATTTCTTACAAGCATTCAAGGTCATGGAC
AAAACCAAGTCAAAGCTAGCAGCGTTTTTTGATGATGACGAGGACTCTTCCTTCCCACAAAAACACGTTGACGAG
GCGAAAATCTCGCAGTATACTTCGGGCACTGTTCGTAAATCGAGGCGCGAAAAAGAGCAAGAGGCTGCTGAAGCC
AAGAAACGAGAAGAGGAAGCTTCCGCGGCTAAAGCATATGCCGAATTCTTGGATGCATTCCAAGGAGACGATGCG
GCTGGAAAGAAGAAATCAACGTTTGTTAGAGCGGGCTCGGATGGAGCAGAATACAACCTGCCTAGGGCTGGTGAG
GTGAACTCTTCAAACACAAGAACGTCTGGTATAGAAAGGTCGATATCACCTGCAATGAGTATGCCGAAGCCGAAG
GGTAAGAGGGCTATGGACGCATTTTTGGAGGAAATTAAAAGGGACCAAGCAGAGAGGGAAGCCAAATATGCGAAG
CAATCCCAAAGTCATGGTCGTTCAGTAACGGCACTTGCAGCCTACGAGGGTCAGAGTGGTAGTAAAGATCGCGGC
GATCCCCAGACTTCGAATGTCTTTGTTGCTAATCTACCCCCGCATGTCACGGAAGAGTCTCTGGGCAATTTCTTT
GCCCGAGCGGGACCGGTGGGCTCTGTCAAAATCATGTGGCCCAGATCCGACGCTACGGTAGGTCCTGGTGCAGAT
ATGACCGCGTCTCGAAGGAGCGGCAAGGCGGGGTTAAGCGGTTTTGTTTCTTTTATGAAACGCCATGATGCTGAA
GAGGCGCTACGCGAGTTTGATGGATACGATTGGGGAGGTTCTGTCTTACGAGTTGGATGGAGTAAAGCTGTTCCC
ATTGCAGCGAAACCGAAATATGTCGCGGCTTCATACTATCGAGAACATGGGACAAGCCGGAGCCGTTCCAGGGAA
CGTCCGCGGTCCCGTTCACAAGACAAATATTACAGACGGTCGCATCGCTCTCGCAGCCAATCTTACGACAGAGAC
AGGAACAGAAGCCCATCCCAGTCTCGTCGTAGATCTCGTAGTCGGTCGCGGCATCGACACTATTCCTCTCGCAGT
CGTTCACCACGACGACGTTATTCCCGCAGCCCACTCAGTAGAGCTCATACTGAAGAGGAAGAGGCAGTCACTGAT
ACTTTCATTCGAGCCGTTGCTTCAGAGGTAAAAGGCCAAGATTTGAAGTACGAGGAAGTACTTAGGGAGCGCGAA
CGCAACAACCCCAAATACGCATTCTTGATTCATAGAAATCACCGGCGACATGCATTTTATCGTGGTTTGGTGGAG
TCTGACCGTATTCTAAAGCCGGAATTCGATGATGATGGCTACAATTCTATCTATTCATCTGATTCCGCCGAGGAA
TCAGAAAGAGAACGCGGTCGTAGAAGCAAACTAGGAAAATTGGCGAGGAAACGATTCGAGGCGATGCTCCGTGGG
ATGTCAGGCAAGCGAGGCGAGATCGCAAGATGCATGGCATTCAGCCTCGAACACGCTGAAGCAGCACATGAGATT
GTAGACGTCATTGTTGCCTCCCTCCTAGTGGATAGCACTGCCGTACCAAGAAAAGTCGCTCGATTGCACCTTATT
TGTGACATTCTCCACAATTCAGCCGCAACCGTACCAAGTGCTTGGAAGTTCAGGCAGGAATTTCAGTCCCGGCTC
GGCATTGTGTTTGATCATCTTGCAAACATTTATCATTCCTTCCCTGGTCGCATGACAGCAGAGACTTTCAAGAAG
CAAATTATCGCTATCGTTGAGATCTGGGAGGACTGGATTGTATTTCCTCCGGAGGTGACAGCTGAGCTACGCCAA
CGACTCGAAGGTGCCGCGGTGCCATCCGAAACGAAGGTAGAGGACAAGGAAGAAAAAGTGGAAGAACAGAAGAGC
TCATTCAGTTCTCGGTTCAAGCAAAGCTCGTTCAAGCTTGCCACCGATACTTCGTCCGCTGATGAGAATGTCATG
GACGATATGGATGGTGAACCTCTGGACAACGTAGATGGAGAACCAGTGGATGACGTAGATGGAGAACCAGTGGAA
GATATAGACGGAGCACCTGTGGACGATGTAGATGGGGAACCTATGGAGGACATTGACGGCATGCCTATGGATGAT
GATATCGACGGTGAACCTGCAGATGCGGACATGGCTTCTGTAGCTGATGTTTAA
Gene >AgabiH97|042960
ATGTCTAATTTATCCTCATCGGCCACATCATCTCCCACCTTGGTCGAGTCGACGCCGCACTCATCAGTCCCCTCG
CCTCAGATGAACAGCCTTTCCCTGACAGACCCTATCACCATTTCCGATGAAGATAAGAAAGAGGCTGCACGGATA
AAAACTGAAGCCAACAAAGCATTTACAAGTTATGGGATTCGTATCTTAATCCCCAGTCTTCTTCATTGTGATATT
TTGGTTTCTAGGCCACAACTATACCGTCGCAGCCAAACTCTACTCGGATGCGATCGAGAAAAATCATAGTGACCC
TACACTATGGTGTAATCGTGCTTATACCAGGATGAAATTAGAGGAATTTGGGTATGCTTTGAACGATACAAGTGC
GGTAAATCAGCGGCGACAACTGTGTGGATTCTGAAACGAGACATCATCTATCTTAGCGCAAGCTATCAGTCTTGA
CCCCCGATACGTGAAGGCTTATTACCGGTTAGTTGTTCCACGTGGCCTTTTTAGTATTCTCTTACGGTTCATCTC
CAAGGACAGTCGGGCGACATGTTATCTACAGACTCTCAGACCTCAGTTTGCGGTCGTAGACTTCAAGAAAATTCT
GGCCATTGAGCCCAAGAATGAGACAGTGCGACAGCAAATGGTCTCGACGCAGAAACTTATAAGGAGAACTGAATT
TGAGAAGGTTGGATTGAAGAATACTGTTTTGATCTGATCAGCGCCCACTTAAATATGTGTATATTTACAGGCGAT
CGAAATGGAAGAAGAAAAAGATGCTGTGGCCAGATGCTTAGAAATTATTGCCGAAGGTGTGTGTAATCATCTCAT
TTTTCAGAATAGTGTATTTACAGTGGTGGTGATAGGTGGCTGCGAAATGGATAAAGCGTATACGGGTCCCAAATT
ACCTTATGACGACGGAAAATTCCAGATCACCATCGAGTTCATTCGTAGCATGATCCAGTGGTTCAAAGACGGAAA
GACGTTGCCGAAACGTTATGTTTGGGAAATCGCATTGGGTGCTCATGCCGCTTTCGCTTCTGAAGAAAGTTTGGT
CGAATTATCCATCCCTGACGATATCACAGTTGATGTCATCGGAGATGTTCATGGTATGTTTCTTTCTTCCAACGC
TATGCAGGACCATAGTAGAAAACTGAAGACATCAAGGTCAATTCTATGATGTGCTACATCTGTTCTCGCTTACTG
GGGAGCCTGGTGAGAAGCATTATTTGCTTATGAATGGTGATCTCGTGGATAGAGGTTCATGGTCCATGGAGGTCA
TTCTGGTTGCTTTTGCCTACAAATGTGCGTTATGTCTCTCAATTTCAGGCGCATTTGTTGAGATGAAGCCAGGGT
TATATCCGAAGTATATGTTTATCAACCGTGGTAACCATGAAGCAAAAGATATGAATCGGACATACGGGTTCGAAG
GCGAAGCCAAGCAAAAACACGGTGACCAGAGTTACAAGGTGAGTCGAAAATCAATGTACATCGCGCCACGCTCAT
GACATTATAAGTTATTTGCGCACATATTCACCACCTGTATGTCGACTCATTTTCTTCTCTTACTTTATACTCATC
GTTCGACAGTGCCTTTGGCAACTCTGGTGAGCGGTACCAAGCCTCCAACGACCAAGGAAGCCGCCGGTGCCATAC
TCTCACCTGATGGATTCAAACGGTATTTCGTTGTTCATGGTGGTTTGTTCAGTCAAGATCAGGTAACTTTGGATG
ATGTCCGAAAAATTCAACGGGTTGGCCGTCAGCCTGGTACTGAAGGATTGATGTGTATGTTATTCCCTTTCCTTC
TCTTTCCATTACTCGCTGACCGGCGATCACAGGCGAGGTACTTGTCGAACGAGATATATTTGTATTCGATACTGA
CAAGCCTCAATTGAAAGCTATTATGGACCGACCCTCAAGAAGCACCAGGACGTGGACCAAGTAAACGGGCAAGTA
CTTTTCATTGTTTCATGCTTTCTTGGGCTGAAACGAGCACCCAGGGTGTTGGTATTTCATTTGGACCTGACGTGA
CAAAACGATGGTGTGAACTGAATAGTGTTTCTGGCGTCATAAGAAGTCATGAGGTTCGACAAGGTGGGAATGCAC
GGAGCTTTACGTTCAATGATGTTCTGACAGTCGCTGTCATAGATGGCTACCAGGTAGAACATGATGGCCTTTGCA
CCACGGTAAGCCTACTGCGACTCTCCGGCGCACATGAACATAACAACATGCCCAGGTGTTCTCCGCGCCGAATTA
TGTTGATCAAGCCGGAAATAAAGGCGCTTTTGTACGTGCATATTCGTCGTTTTGCTACGCAGAAGTTGATGAAGT
CGATCACAGATCCGCATTGATGCTGCTGGCAAACAGGAATTTTTCCAGTTTGAGGCCAAGCCTCATCCCCCTATG
AAACCGATGGCTTATGTTCAAGGCGGTCTCGGCAACCTTATGATGATGTGATTTTGAAGGGAATATGTTGGGTCT
TTGCTTGTATTTCTTACTGGCTCGTGTGAATTTCATGTGAATTGTGACTGGGTCACTAGCACTCGCCATCAATAT
ATCATTTCTGAGCCTCTCGACCTTCGTTCTTCAACGCCCGACCATTTCTTACAAGCATTCAAGGTCATGGACAAA
ACCAAGTCAAAGCTAGCAGCGTTTTTTGATGATGACGAGGACTCTTCCTTCCCAGTGCGATGGACAGAGCTATTT
CTTGCTTTGATCATGCTCACCATTTGTTCCTCGTCCAATTAGCAAAAACACGTTGACGAGGCGAAAATCTCGCAG
TATACTTCGGGCACTGTTCGTAAATCGAGGCGCGAAAAAGAGCAAGAGGCTGCTGAAGCCAAGAAACGAGAAGAG
GAAGCTTCCGCGGCTAAAGCATATGCCGAATTCTTGGATGCATTCCAAGGAGACGATGCGGCTGGAAAGAAGAAA
TCAACGTTTGTTAGAGCGGGCTCGGATGGAGCAGAATACAACCTGCCTAGGGCTGGTGAGGTGAACTCTTCAAAC
ACAAGAACGTCTGGTATAGAAAGGGTAAGTTAGAAGGTTGTTTTAACCCTTCCTCTCAGCTTATAGTTCACCAGT
CGATATCACCTGCAATGAGTATGCCGAAGCCGAAGGGTAAGAGGGCTATGGACGCATTTTTGGAGGAAATTAAAA
GGTTCGGGCAATACTTGGAGTACTGTGAACAAAGTTAAACGGCTGTATAGGGACCAAGCAGAGAGGGAAGCCAAA
TATGCGAAGCAATGTACGTTCCACAGGTTTTATAAACCACCAGGTTCTTATCCGGTTTTGTAGCCCAAAGTCATG
GTCGTTCAGTAACGGCACTTGCAGGTGAGTCAATGTCTGCTTTCAAACCTTCACAAATGTGAATCCTTTCGTTTT
ATTAGCCTACGAGGGTCAGAGTGGTAGTAAAGATCGCGGCGATCCCCAGGTGACAAGTTTTTTCCATCAATTACC
TTCTGAAACTAATATTTCTGCTAGACTTCGAATGTCTTTGTTGCTAATCTACCCCCGCATGTCACGGAAGAGTCT
CTGGGCAATTTCTTTGCCCGAGCGGGACCGGTGGGCTCTGTAAGATATCTCAATTACTTTCCTCGTGCTCTGACT
TATTGTTTTAAGGTCAAAATCATGTGGCCCAGATCCGACGCTACGGTAGGTCCTGGTGCAGATATGACCGCGTCT
CGAAGGAGCGGCAAGGCGGGGTTAAGCGGTTTTGTTTCTTTTATGAAACGCCATGATGCTGAAGAGGCGCTACGC
GAGTTTGATGGATACGATTGGGGAGGTTCTGTCTTACGAGTTGGATGGAGTAAAGCTGTTCCCATTGCAGCGAAA
CCGAAATATGGTGAGTTTTCAAATTGGAAATAATCAATGATGTCTATTGATCCGTTCTATCCCAAGTCGCGGCTT
CATACTATCGAGAACATGGGACAAGCCGGAGCCGTTCCAGGGAACGTCCGCGGTCCCGTTCACAAGACAAATATT
ACAGACGGTCGCATCGCTCTCGCAGCCAATCTTACGACAGAGACAGGAACAGAAGCCCATCCCAGTCTCGTCGTA
GATCTCGTAGTCGGTCGCGGCATCGACACTATTCCTCTCGCAGTCGTTCACCACGACGACGTTATTCCCGCAGCC
CACTCAGTAGAGCTCATACTGAAGAGGAAGAGGCAGTCACTGATACTTTCATTCGAGCCGTTGCTTCAGAGGTAA
AAGGCCAAGATTTGAAGTACGAGGAAGTACTTAGGGAGCGCGAACGCAACAACCCCAAATACGCATTCTTGATTC
ATAGAAATGTTGGTTGTACTTCTTTGGCCACCCTTTCTGTTATTGATCGTTTGCAGCACCGGCGACATGCATTTT
ATCGTGGTTTGGTGGAGTCTGACCGTATTCTAAAGCCGGAATTCGATGATGATGTCAGTAGAAACCATTGTACCA
CGCTGCAGCCACCTAACGGTTATGTACAGGGCTACAATTCTATCTATTCATCTGATTCCGCCGAGGAATCAGAAA
GAGAACGCGGTCGTAGAAGCAAACTAGGAAAATTGGCGAGGAAACGATTCGAGGCGATGCTCCGTGGGATGTCAG
GCAAGCGAGGCGAGATCGCAAGATGCATGGCATTCAGCCTCGAACACGCTGAAGCAGCACATGAGGTAGCGATTC
TTTTCGAAATGTTTTCCCACTTGGCTCATTCGGAAATAGATTGTAGACGTCATTGTTGCCTCCCTCCTAGTGGAT
AGCACTGCCGTACCAAGAAAAGTCGCTCGATTGCACCTTATTTGTGACATTCTCCACAATTCAGCCGCAACCGTA
CCAAGTGCTTGGAAGTTCAGGCAGGAATTTCAGTCCCGGCTCGGCATTGTGTTTGATCATCTTGCAAACATTTAT
CATTCCTTCCCTGGTCGCATGACAGCAGAGACTTTCAAGAAGCAAATTATCGCTATCGTTGAGATCTGGGAGGAC
TGGATTGTATTTCCTCCGGAGGTGACAGCTGAGCTACGCCAACGACTCGAAGGTGCCGCGGTGCCATCCGAAACG
AAGGTAGAGGACAAGGAAGAAAAAGTGGAAGAACAGAAGAGCTCATTCAGTTCTCGGTTCAAGCAAAGCTCGTTC
AAGCTTGCCACCGATACTTCGTCCGCTGATGAGAATGTCATGGACGATATGGATGGTGAACCTCTGGACAACGTA
GATGGAGAACCAGTGGATGACGTAGATGGAGAACCAGTGGAAGATATAGACGGAGCACCTGTGGACGATGTAGAT
GGGGAACCTATGGAGGACATTGACGGCATGCCTATGGATGATGATATCGACGGTGAACCTGCAGATGCGGACATG
GCTTCTGTAGCTGATGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail