Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042950
Gene name
Locationscaffold_2:1110672..1114913
Strand+
Gene length (bp)4241
Transcript length (bp)3717
Coding sequence length (bp)3717
Protein length (aa) 1239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 4.5E-08 164 247
PF00013 KH_1 KH domain 7.2E-07 559 623
PF00013 KH_1 KH domain 2.5E-11 641 712
PF00013 KH_1 KH domain 1.2E-07 725 794
PF00013 KH_1 KH domain 1.1E-13 807 870
PF00013 KH_1 KH domain 1.4E-11 964 1038
PF00013 KH_1 KH domain 2.3E-10 1174 1225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59810|VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vgl1 PE=1 SV=2 40 1226 2.0E-113
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 26 1227 8.0E-69
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 52 1227 3.0E-68
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 52 1227 5.0E-67
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 26 1227 7.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59810|VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vgl1 PE=1 SV=2 40 1226 2.0E-113
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 26 1227 8.0E-69
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 52 1227 3.0E-68
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 52 1227 5.0E-67
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 26 1227 7.0E-65
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 26 1227 6.0E-64
sp|P06105|SC160_YEAST Protein SCP160 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCP160 PE=1 SV=3 16 1226 1.0E-61
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 175 759 6.0E-19
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 162 998 1.0E-18
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 162 998 2.0E-18
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 162 998 5.0E-18
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 162 998 9.0E-17
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 146 720 1.0E-16
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 146 720 2.0E-16
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 146 720 1.0E-13
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 475 998 1.0E-10
sp|Q5U4T7|BIC1B_XENLA Protein bicaudal C homolog 1-B OS=Xenopus laevis GN=bicc1-b PE=2 SV=1 642 909 2.0E-10
sp|Q9IA00|BIC1A_XENLA Protein bicaudal C homolog 1-A OS=Xenopus laevis GN=bicc1-a PE=2 SV=1 642 909 5.0E-10
sp|Q99MQ1|BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus GN=Bicc1 PE=1 SV=1 642 909 3.0E-09
sp|Q9H694|BICC1_HUMAN Protein bicaudal C homolog 1 OS=Homo sapiens GN=BICC1 PE=1 SV=2 642 909 9.0E-09
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 464 720 2.0E-07
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 644 1043 3.0E-07
sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 647 996 2.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 808 868 2.0E-06
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 808 995 2.0E-06
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 808 995 2.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 808 868 2.0E-06
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 640 904 3.0E-06
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 808 995 3.0E-06
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 808 995 6.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 808 860 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042950
MVNPALTAADLQRRHELEGAPDPFPSFAEVNHTKAKVKVASKADLDTQSETAFPSLAPSASTPAAPTTSAWGGPR
IRPAVPKQPVFSNSITLPAIDLSSAGRDGKQATLGEIMKRVTTKYKVKLEASTNQKTRQTTFFLKAESEKDLEKA
KRSLVALLSPDTTLVINAPASTIATIIGPRGATLKQIRDQTGIKVDIPKKEANGNSHIGNGNAGDVTPSLDNDEE
EPTVPVTLTGPVPFIYEAQELLNQLISSKISKATQRVRDIPAHILPFIIARKTFFLSTAQEAGVTLTLNTPNREI
TASGERDGVIRLVELIKSNIETFKTGITFLKLAVPKRQHRLLVGDAVQQIMAESKCSIAVPDSDDSSDEITIWGQ
GSDLPNGLTAVMQHANSKYIHEFPIPGHVSIARNLVTFFRYISYDQILKEKIPGVTVFLPSASQDKTSYTIDLVG
DKPVVDSAVRQVSEAIGKLYGATKDVNIDWLLHRVITVKNAKKIKQFHDAHNVQVFFPQESEESSSVLLVYDPFS
PNASPSPDDKKRHIDDVEKEILKLAKDAADVKGETITVDKRWHEAIIGQNGTTLNAIIGEDKTLVVKFGADAGDN
ATEETVLVRGVSADVDRAVKEIRRIVEDAKNDEIVNSYSIDFEIDREYVGRVVGAQGAGVNKLRDQLGVKVDVND
EEDRETNGKKKKGSSQKSKVKITGRKENVEEAKKRILAQVDRLADETFEVLKIPSQFHASLIGQQGKYAIRLEEK
YAVKITFPRQNVDFEGKTREQLKSDEVLIKGGKKGVASAKAELLDALEVEKESNHVIKFAVPSRAIARILGRGGA
SINEIKDLTGAIVDIDKSSDDPNTTNISVRGTKEAINDAKAQIMEIANSVGEETTVTLTIETKWHRNLIGAGGQG
LRELITRCGGPTDSKAQAGLVRFPRQGEPSDEVRIRGEPKLVNKIKVELEKATATLKDRVVLAVEVPSAQHRVLI
GRGGQHLNELQEKTGAQIQFPGSRSYSHVGEAENAADFTEVDAGDIVKVSGPRAACDAAITELKGQVKPPAPEGV
STTLNVPLKYHHAIAQQGAFYRNLRSIGVRVEQSIQPTQAAVPTGPSSNAVPSARIDEEVEDESMANVKWVVEPN
YQDTEEGESVWTLKAHDQEGLDKAQNLIAEAIKHAEQMSHVGYLTMPDKSSFPRIVGSKGVNVSRLRQETGADIT
VSREDTTITIIGSEADIEAAKTAIIKIASTPAGRSRRD*
Coding >AgabiH97|042950
ATGGTCAATCCGGCTCTGACTGCCGCCGACCTTCAAAGGAGGCACGAGCTTGAAGGAGCTCCAGATCCATTCCCC
TCCTTTGCAGAAGTCAACCATACCAAGGCAAAGGTCAAGGTGGCCTCAAAGGCCGATTTGGATACTCAGTCGGAA
ACTGCTTTCCCCTCCCTTGCTCCATCTGCGTCGACCCCCGCTGCTCCCACTACCTCCGCATGGGGTGGTCCTCGT
ATCAGGCCCGCTGTTCCGAAACAGCCAGTCTTTTCCAATTCTATCACACTCCCAGCTATAGACCTCTCGAGTGCA
GGCAGGGATGGTAAACAAGCAACTCTCGGTGAGATTATGAAGCGGGTGACCACCAAATACAAGGTTAAGTTGGAG
GCTTCCACGAATCAAAAGACACGCCAAACCACGTTTTTCCTCAAGGCAGAATCTGAAAAAGATCTCGAAAAGGCC
AAACGTAGTCTTGTTGCTCTGCTCAGCCCGGATACTACTTTGGTTATCAACGCCCCTGCTTCTACGATCGCGACG
ATCATTGGGCCTCGAGGCGCAACTTTGAAGCAAATTCGGGATCAAACAGGTATTAAAGTCGACATCCCCAAGAAA
GAGGCCAACGGGAACAGTCATATTGGCAATGGCAATGCCGGTGATGTCACCCCATCCTTAGACAACGACGAAGAA
GAACCTACTGTTCCTGTCACTCTCACTGGTCCAGTTCCCTTCATCTATGAGGCACAGGAACTTCTCAACCAGCTC
ATCTCGTCCAAGATTTCTAAGGCTACCCAGCGCGTTCGTGACATTCCAGCCCATATCCTTCCCTTCATTATCGCT
CGCAAAACCTTCTTCTTGTCCACTGCTCAGGAGGCTGGCGTCACTCTCACCCTTAATACTCCCAACCGCGAGATT
ACTGCCAGTGGTGAACGCGATGGTGTTATTCGTCTGGTTGAGCTCATCAAGAGTAACATCGAAACTTTCAAGACT
GGTATAACTTTCCTTAAGCTTGCCGTTCCCAAACGTCAACATCGTCTCCTTGTTGGAGATGCGGTACAACAGATA
ATGGCAGAGAGCAAGTGCTCTATCGCTGTTCCAGATTCTGATGATTCCAGTGATGAAATCACCATTTGGGGTCAA
GGTAGTGACCTCCCTAACGGTCTAACGGCGGTTATGCAACATGCGAACTCCAAATATATCCACGAGTTCCCTATT
CCGGGTCACGTCTCCATTGCTCGCAACCTTGTCACGTTCTTCCGGTACATCTCTTATGACCAGATTCTGAAAGAA
AAGATTCCCGGCGTCACCGTATTTCTTCCCTCTGCCTCACAAGACAAGACATCGTACACTATCGATCTCGTCGGT
GACAAGCCGGTTGTCGATTCCGCTGTTCGTCAGGTCTCTGAAGCGATTGGTAAACTCTACGGTGCGACTAAGGAC
GTCAACATAGATTGGCTTCTCCATCGCGTGATCACGGTCAAGAATGCCAAGAAAATCAAGCAATTCCATGATGCG
CATAATGTTCAAGTCTTTTTCCCTCAAGAATCCGAAGAGTCTTCATCAGTTTTACTTGTCTATGATCCGTTCTCG
CCAAACGCCTCCCCTTCCCCTGATGACAAGAAGCGTCACATCGATGATGTGGAGAAGGAGATATTGAAACTAGCC
AAGGATGCTGCTGACGTTAAGGGCGAAACTATCACTGTGGACAAACGTTGGCACGAGGCTATTATTGGTCAAAAT
GGTACTACATTAAATGCGATCATCGGAGAGGACAAGACGCTCGTCGTCAAATTTGGCGCAGACGCTGGAGACAAT
GCGACCGAGGAAACCGTCCTCGTTCGTGGTGTGAGCGCTGATGTCGATCGGGCTGTCAAAGAAATTCGCCGAATC
GTCGAGGATGCCAAGAACGATGAAATAGTCAACAGCTATTCCATTGACTTCGAGATTGACCGCGAATATGTTGGT
CGCGTCGTTGGTGCTCAGGGTGCTGGAGTTAATAAGCTCAGGGACCAACTTGGTGTCAAGGTCGATGTCAACGAT
GAGGAAGATAGGGAAACTAATGGTAAAAAGAAGAAGGGTTCTTCGCAGAAATCCAAGGTCAAAATCACTGGTCGC
AAAGAGAATGTTGAGGAAGCCAAGAAACGTATCCTGGCTCAGGTTGACCGTCTTGCCGATGAAACATTTGAAGTC
CTCAAAATCCCTAGCCAATTCCATGCCTCCCTCATTGGTCAACAGGGCAAATATGCCATCCGTCTGGAGGAAAAA
TACGCTGTCAAGATCACTTTCCCCCGCCAGAATGTTGATTTTGAGGGCAAGACTCGTGAGCAACTCAAGTCTGAT
GAGGTTCTTATCAAGGGTGGCAAGAAGGGTGTAGCCAGTGCCAAAGCTGAACTACTCGATGCTCTTGAAGTCGAG
AAGGAGTCTAATCACGTCATCAAATTCGCAGTCCCCAGTCGCGCAATTGCTCGCATCCTTGGTAGAGGTGGTGCA
AGTATTAACGAAATCAAAGACCTTACTGGCGCCATTGTTGATATTGACAAGTCGTCGGATGATCCTAATACTACA
AACATCTCCGTCCGTGGTACTAAAGAAGCGATCAATGATGCCAAGGCTCAGATTATGGAGATTGCCAATTCGGTT
GGAGAAGAAACGACTGTCACTTTGACCATTGAAACCAAGTGGCACCGCAATCTGATTGGTGCTGGCGGACAAGGC
CTCAGAGAACTCATTACTCGCTGTGGTGGACCAACTGACTCTAAAGCGCAGGCTGGCCTGGTGAGATTCCCTCGT
CAAGGGGAACCTTCTGATGAAGTCCGTATTCGGGGTGAACCCAAGCTTGTCAACAAAATAAAAGTCGAGCTCGAG
AAGGCTACCGCTACCCTGAAGGATCGCGTTGTTCTCGCTGTGGAGGTCCCGTCCGCTCAACATCGCGTCCTCATA
GGTCGTGGTGGTCAGCACTTGAATGAACTCCAGGAAAAGACTGGCGCCCAGATTCAATTCCCCGGTTCTCGTTCT
TACAGTCATGTTGGGGAAGCAGAGAATGCTGCAGATTTTACTGAGGTTGATGCTGGTGATATCGTGAAGGTTTCT
GGCCCTCGCGCTGCTTGCGACGCTGCCATCACAGAGCTAAAGGGTCAGGTCAAACCGCCAGCTCCTGAAGGCGTT
TCTACAACATTGAATGTGCCGTTAAAATACCATCACGCCATTGCTCAACAAGGTGCATTCTACCGCAACCTTCGA
TCCATTGGTGTCCGTGTCGAGCAATCTATCCAACCTACCCAAGCTGCTGTTCCAACCGGTCCAAGTTCTAATGCT
GTTCCTTCGGCCCGCATTGATGAGGAGGTTGAGGATGAATCGATGGCTAACGTCAAGTGGGTTGTTGAGCCCAAT
TACCAGGATACAGAAGAAGGGGAATCAGTTTGGACCCTCAAGGCTCATGACCAGGAGGGTTTGGACAAAGCACAA
AACCTCATTGCTGAGGCTATTAAACATGCGGAGCAGATGAGCCATGTTGGCTACCTCACCATGCCCGACAAGAGC
TCTTTCCCTAGAATTGTTGGTTCCAAGGGTGTTAATGTTTCCCGCCTCCGGCAGGAGACTGGCGCCGATATCACT
GTGAGTCGCGAGGACACAACCATTACGATCATCGGCTCTGAAGCTGATATCGAGGCTGCCAAGACTGCGATTATT
AAAATTGCCTCCACTCCAGCTGGCCGGTCGCGTCGCGATTAA
Transcript >AgabiH97|042950
ATGGTCAATCCGGCTCTGACTGCCGCCGACCTTCAAAGGAGGCACGAGCTTGAAGGAGCTCCAGATCCATTCCCC
TCCTTTGCAGAAGTCAACCATACCAAGGCAAAGGTCAAGGTGGCCTCAAAGGCCGATTTGGATACTCAGTCGGAA
ACTGCTTTCCCCTCCCTTGCTCCATCTGCGTCGACCCCCGCTGCTCCCACTACCTCCGCATGGGGTGGTCCTCGT
ATCAGGCCCGCTGTTCCGAAACAGCCAGTCTTTTCCAATTCTATCACACTCCCAGCTATAGACCTCTCGAGTGCA
GGCAGGGATGGTAAACAAGCAACTCTCGGTGAGATTATGAAGCGGGTGACCACCAAATACAAGGTTAAGTTGGAG
GCTTCCACGAATCAAAAGACACGCCAAACCACGTTTTTCCTCAAGGCAGAATCTGAAAAAGATCTCGAAAAGGCC
AAACGTAGTCTTGTTGCTCTGCTCAGCCCGGATACTACTTTGGTTATCAACGCCCCTGCTTCTACGATCGCGACG
ATCATTGGGCCTCGAGGCGCAACTTTGAAGCAAATTCGGGATCAAACAGGTATTAAAGTCGACATCCCCAAGAAA
GAGGCCAACGGGAACAGTCATATTGGCAATGGCAATGCCGGTGATGTCACCCCATCCTTAGACAACGACGAAGAA
GAACCTACTGTTCCTGTCACTCTCACTGGTCCAGTTCCCTTCATCTATGAGGCACAGGAACTTCTCAACCAGCTC
ATCTCGTCCAAGATTTCTAAGGCTACCCAGCGCGTTCGTGACATTCCAGCCCATATCCTTCCCTTCATTATCGCT
CGCAAAACCTTCTTCTTGTCCACTGCTCAGGAGGCTGGCGTCACTCTCACCCTTAATACTCCCAACCGCGAGATT
ACTGCCAGTGGTGAACGCGATGGTGTTATTCGTCTGGTTGAGCTCATCAAGAGTAACATCGAAACTTTCAAGACT
GGTATAACTTTCCTTAAGCTTGCCGTTCCCAAACGTCAACATCGTCTCCTTGTTGGAGATGCGGTACAACAGATA
ATGGCAGAGAGCAAGTGCTCTATCGCTGTTCCAGATTCTGATGATTCCAGTGATGAAATCACCATTTGGGGTCAA
GGTAGTGACCTCCCTAACGGTCTAACGGCGGTTATGCAACATGCGAACTCCAAATATATCCACGAGTTCCCTATT
CCGGGTCACGTCTCCATTGCTCGCAACCTTGTCACGTTCTTCCGGTACATCTCTTATGACCAGATTCTGAAAGAA
AAGATTCCCGGCGTCACCGTATTTCTTCCCTCTGCCTCACAAGACAAGACATCGTACACTATCGATCTCGTCGGT
GACAAGCCGGTTGTCGATTCCGCTGTTCGTCAGGTCTCTGAAGCGATTGGTAAACTCTACGGTGCGACTAAGGAC
GTCAACATAGATTGGCTTCTCCATCGCGTGATCACGGTCAAGAATGCCAAGAAAATCAAGCAATTCCATGATGCG
CATAATGTTCAAGTCTTTTTCCCTCAAGAATCCGAAGAGTCTTCATCAGTTTTACTTGTCTATGATCCGTTCTCG
CCAAACGCCTCCCCTTCCCCTGATGACAAGAAGCGTCACATCGATGATGTGGAGAAGGAGATATTGAAACTAGCC
AAGGATGCTGCTGACGTTAAGGGCGAAACTATCACTGTGGACAAACGTTGGCACGAGGCTATTATTGGTCAAAAT
GGTACTACATTAAATGCGATCATCGGAGAGGACAAGACGCTCGTCGTCAAATTTGGCGCAGACGCTGGAGACAAT
GCGACCGAGGAAACCGTCCTCGTTCGTGGTGTGAGCGCTGATGTCGATCGGGCTGTCAAAGAAATTCGCCGAATC
GTCGAGGATGCCAAGAACGATGAAATAGTCAACAGCTATTCCATTGACTTCGAGATTGACCGCGAATATGTTGGT
CGCGTCGTTGGTGCTCAGGGTGCTGGAGTTAATAAGCTCAGGGACCAACTTGGTGTCAAGGTCGATGTCAACGAT
GAGGAAGATAGGGAAACTAATGGTAAAAAGAAGAAGGGTTCTTCGCAGAAATCCAAGGTCAAAATCACTGGTCGC
AAAGAGAATGTTGAGGAAGCCAAGAAACGTATCCTGGCTCAGGTTGACCGTCTTGCCGATGAAACATTTGAAGTC
CTCAAAATCCCTAGCCAATTCCATGCCTCCCTCATTGGTCAACAGGGCAAATATGCCATCCGTCTGGAGGAAAAA
TACGCTGTCAAGATCACTTTCCCCCGCCAGAATGTTGATTTTGAGGGCAAGACTCGTGAGCAACTCAAGTCTGAT
GAGGTTCTTATCAAGGGTGGCAAGAAGGGTGTAGCCAGTGCCAAAGCTGAACTACTCGATGCTCTTGAAGTCGAG
AAGGAGTCTAATCACGTCATCAAATTCGCAGTCCCCAGTCGCGCAATTGCTCGCATCCTTGGTAGAGGTGGTGCA
AGTATTAACGAAATCAAAGACCTTACTGGCGCCATTGTTGATATTGACAAGTCGTCGGATGATCCTAATACTACA
AACATCTCCGTCCGTGGTACTAAAGAAGCGATCAATGATGCCAAGGCTCAGATTATGGAGATTGCCAATTCGGTT
GGAGAAGAAACGACTGTCACTTTGACCATTGAAACCAAGTGGCACCGCAATCTGATTGGTGCTGGCGGACAAGGC
CTCAGAGAACTCATTACTCGCTGTGGTGGACCAACTGACTCTAAAGCGCAGGCTGGCCTGGTGAGATTCCCTCGT
CAAGGGGAACCTTCTGATGAAGTCCGTATTCGGGGTGAACCCAAGCTTGTCAACAAAATAAAAGTCGAGCTCGAG
AAGGCTACCGCTACCCTGAAGGATCGCGTTGTTCTCGCTGTGGAGGTCCCGTCCGCTCAACATCGCGTCCTCATA
GGTCGTGGTGGTCAGCACTTGAATGAACTCCAGGAAAAGACTGGCGCCCAGATTCAATTCCCCGGTTCTCGTTCT
TACAGTCATGTTGGGGAAGCAGAGAATGCTGCAGATTTTACTGAGGTTGATGCTGGTGATATCGTGAAGGTTTCT
GGCCCTCGCGCTGCTTGCGACGCTGCCATCACAGAGCTAAAGGGTCAGGTCAAACCGCCAGCTCCTGAAGGCGTT
TCTACAACATTGAATGTGCCGTTAAAATACCATCACGCCATTGCTCAACAAGGTGCATTCTACCGCAACCTTCGA
TCCATTGGTGTCCGTGTCGAGCAATCTATCCAACCTACCCAAGCTGCTGTTCCAACCGGTCCAAGTTCTAATGCT
GTTCCTTCGGCCCGCATTGATGAGGAGGTTGAGGATGAATCGATGGCTAACGTCAAGTGGGTTGTTGAGCCCAAT
TACCAGGATACAGAAGAAGGGGAATCAGTTTGGACCCTCAAGGCTCATGACCAGGAGGGTTTGGACAAAGCACAA
AACCTCATTGCTGAGGCTATTAAACATGCGGAGCAGATGAGCCATGTTGGCTACCTCACCATGCCCGACAAGAGC
TCTTTCCCTAGAATTGTTGGTTCCAAGGGTGTTAATGTTTCCCGCCTCCGGCAGGAGACTGGCGCCGATATCACT
GTGAGTCGCGAGGACACAACCATTACGATCATCGGCTCTGAAGCTGATATCGAGGCTGCCAAGACTGCGATTATT
AAAATTGCCTCCACTCCAGCTGGCCGGTCGCGTCGCGATTAA
Gene >AgabiH97|042950
ATGGTCAATCCGGCTCTGACTGCCGCCGACCTTCAAGTGCGTAGTGGTTTTTCCTATGCTTCGCTCTATTGAGTA
TCATGTTCAGAGGAGGCACGAGCTTGAAGGAGCTCCAGATCCATTCCCCTCCTTTGCAGAAGTCAACCATACCAA
GGCAAAGGTCAAGGTGGCCTCAAAGGCCGATTTGGATACTCAGTCGGAAACTGCTTTCCCCTCCCTTGCTCCATC
TGCGTCGACCCCCGCTGCTCCCACTACCTCCGCATGGGGTGGTCCTCGTATCAGGCCCGCTGTTCCGAAACAGCC
AGTCTTTTCCAATTCTATCACACTCCCAGCTATAGACCTCTCGAGTGCAGGCAGGGATGGTAAACAAGCAACTCT
CGGTGAGATTATGAAGCGGGTGACCACCAAATACAAGGTTAAGTTGGAGGCTTCCACGAATCAAAAGACACGCCA
AACCACGTTTTTCCTCAAGGCAGAATCTGAAAAAGATCTCGAAAAGGCCAAACGTAGTCTTGTTGCTCTGCTCAG
CCCGGATGTACGTAATCGTGTGAATGGTTGCAATTTTATGTTCATTCGCTGAGCTACTTTTACGTAGACTACTTT
GGTTATCAACGCCCCTGCTTCTACGATCGCGACGATCATTGGGCCTCGAGGTTAGTCAATTGAGGGGCTAAATCT
AACTTTGCTGACGAGTTCTCTCAGGCGCAACTTTGAAGCAAATTCGGGATCAAACAGGTATTAAAGTCGACATCC
CCAAGAAAGAGGCCAACGGGAACAGTCATATTGGCAATGGCAATGCCGGTGATGTCACCCCATCCTTAGACAACG
ACGAAGAAGAACCTACTGTTCCTGTCACTCTCACTGGTCCAGTTCCCTTCATCTATGAGGCACAGGAACTTCTCA
ACCAGCTCATCTCGTCCAAGATTTCTAAGGCTACCCAGCGCGTTCGTGACATTCCAGCCCATATCCTTCCCTTCA
TTATCGCTCGCAAAACCTTCTTCTTGTCCACTGCTCAGGAGGCTGGCGTCACTCTCACCCTTAATACTCCCAACC
GCGAGATTACTGCCAGTGGTGAACGCGATGGTGTTATTCGTCTGGTTGAGCTCATCAAGAGTAACATCGAAACTT
TCAAGACTGGTATAACTTTCCTTAAGCTTGCCGTTCCCAAACGTCAACATCGTCTCCTTGTTGGAGATGCGGTAC
AACAGATAATGGCAGAGAGCAAGTGCTCTATCGCTGTTCCAGATTCTGATGATTCCAGTGATGAAATCACCATTT
GGGGTCAAGGTAGTGACCTCCCTAACGGTCTAACGGCGGTTATGCAACATGCGAACTCCAAATATATCCACGAGT
TCCCTATTCCGGGTCACGTCTCCATTGCTCGCAACCTTGTCACGTTCTTCCGGTACATCTCTTATGACCAGATTC
TGAAAGAAAAGATTCCCGGCGTCACCGTATTTCTTCCCTCTGCCTCACAAGACAAGACATCGTACACTATCGATC
TCGTCGGTGACAAGCCGGTTGTCGATTCCGCTGTTCGTCAGGTCTCTGAAGCGATTGGTAAACTCTACGGTGCGA
CTAAGGACGTCAACATAGATTGGCTTCTCCATCGCGTGATCACGGTCAAGAATGCCAAGAAGTATGTCCTGTGAA
ATATGTCTACTGCCCGAAAATAACTGTTTTCTTCTGCAGAATCAAGCAATTCCATGATGCGCATAATGTTCAAGT
CTTTTTCCCTCAAGAATCCGAAGAGTCTTCATCAGTTTTACTTGTCTATGATCCGTTCTCGCCAAACGCCTCCCC
TTCCCCTGATGACAAGAAGCGTCACATCGATGATGTGGAGAAGGAGATATTGAAACTAGCCAAGGATGCTGCTGA
CGTTAAGGGCGAAACTATCACTGTGGACAAACGTTGGCACGAGGCTATTATTGGTCAAAATGGTACTACATTAAA
TGCGTAAGTCAATAAGTTTCTGTTTGTCCATTGCGCTAAAGCCCCTTTCTAGGATCATCGGAGAGGACAAGACGC
TCGTCGTCAAATTTGGCGCAGACGCTGGAGACAATGCGACCGAGGAAACCGTCCTCGTTCGTGGTGTGAGCGCTG
ATGTCGATCGGGCTGTCAAAGAAATTCGCCGAATCGTCGAGGATGCCAAGAACGATGAAATAGTCAACAGCTATG
TGAGCTTTCTTGCACGATAATAGGCGACCATATCACTTATCTCTACTCATAGTCCATTGACTTCGAGATTGACCG
CGAATATGTTGGTCGCGTCGTTGGTGCTCAGGGTGCTGGAGTTAATAAGCTCAGGGACCAACTTGGTGTCAAGGT
CGATGTCAACGATGAGGAAGATAGGGAAACTAATGGTAAAAAGAAGAAGGGTTCTTCGCAGAAATCCAAGGTCAA
AATCACTGGTCGCAAAGAGAATGTTGAGGAAGCCAAGAAACGTATCCTGGCTCAGGTTGACCGTCTTGTGCGTGT
TCCAATACCGTAGTACATTGAAGAAAAAACTGACTTTTTATTCCCACTAGGCCGATGAAACATTTGAAGTCCTCA
AAATCCCTAGCCAATTCCATGCCTCCCTCATTGGTCAACAGGGCAAATATGCCATCCGTCTGGAGGAAAAATACG
CTGTCAAGATCACTTTCCCCCGCCAGAATGTTGATTTTGAGGGCAAGACTCGTGAGCAACTCAAGTCTGATGAGG
TTCTTATCAAGGGTGGCAAGAAGGGTGTAGCCAGTGCCAAAGCTGAACTACTCGATGCTCTTGAAGTCGAGAAGG
AGTCTAATCACGTCATCAAATTCGCAGTCCCCAGTCGCGCAATTGCTCGCATCCTTGGTAGAGGTGGTGCAAGTA
TTAACGAAATCAAAGACCTTACTGGCGCCATTGTTGATATTGACAAGTCGTCGGATGATCCTAATACTACAAACA
TCTCCGTCCGTGGTACTAAAGAAGCGATCAATGATGCCAAGGCTCAGATTATGGAGATTGCCAATTCGGTTGGAG
AAGAAACGACTGTCACTTTGACCATTGAAACCAAGTGGCACCGCAATCTGATTGGTGCTGGCGGACAAGGCCTCA
GAGAACTCATTACTCGCTGTGGTGGACCAACTGACTCTAAAGCGCAGGCTGGCCTGGTGAGATTGTAAGGGACAT
GCTTATATTCTCGAACGATTATTAACGACCATCTGTCTAGCCCTCGTCAAGGGGAACCTTCTGATGAAGTCCGTA
TTCGGGGTGAACCCAAGCTTGTCAACAAAATAAAAGTCGAGCTCGAGAAGGCTACCGCTACCCTGAAGGATCGCG
TTGTTCTCGCTGTGGAGGTCCCGTCCGCTCAACATCGCGTCCTCATAGGTCGTGGTGGTCAGCACTTGAATGAAC
TCCAGGAAAAGACTGGCGCCCAGATTCAATTCCCCGGTTCTCGTTCTTACAGTCATGTTGGGGAAGCAGAGAATG
CTGCAGATTTTACTGAGGTTGATGCTGGTGATATCGTGAAGGTTTCTGGCCCTCGCGCTGCTTGCGACGCTGCCA
TCACAGAGCTAAAGGTGCGTCTGTCCCGGACAAAAAGCGTGGAATTATACTTAGATTTCGATTAGGGTCAGGTCA
AACCGCCAGCTCCTGAAGGCGTTTCTACAACATTGAATGTGCCGTTAAAATACCATCACGCCATTGCTCAACAAG
GTGCATTCTACCGCAACCTTCGATCCATTGGTGTCCGTGTCGAGCAATCTATCCAACCTACCCAAGCTGCTGTTC
CAACCGGTCCAAGTTCTAATGCTGTTCCTTCGGCCCGCATTGATGAGGAGGTTGAGGATGAATCGATGGCTAACG
TCAAGTGGGTTGTTGAGCCCAATTACCAGGATACAGAAGAAGGGGAATCAGTTTGGACCCTCAAGGCTCATGACC
AGGAGGGTTTGGACAAAGCACAAAACCTCATTGCTGAGGCTATTAAACATGCGGAGCAGATGAGCCATGTTGGCT
ACCTCACCATGCCCGACAAGAGCTCTTTCCCTAGAATTGTTGGTTCCAAGGGTGTTAATGTTTCCCGCCTCCGGC
AGGAGACTGGCGCCGATATCACTGTGAGTCGCGAGGACACAACCATTACGATCATCGGTAAGTCAATGTGTTTCC
GAGTATACCAGTGGCTAACGTAGACCATCACAGGCTCTGAAGCTGATATCGAGGCTGCCAAGACTGCGATTATTA
AAATTGCCTCCACTCCAGCTGGCCGGTCGCGTCGCGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail