Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042930
Gene name
Locationscaffold_2:1105890..1109986
Strand-
Gene length (bp)4096
Transcript length (bp)3039
Coding sequence length (bp)3039
Protein length (aa) 1013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04137 ERO1 Endoplasmic Reticulum Oxidoreductin 1 (ERO1) 6.0E-127 74 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 64 463 2.0E-87
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 62 425 2.0E-86
sp|Q7X9I4|ERO2_ARATH Endoplasmic reticulum oxidoreductin-2 OS=Arabidopsis thaliana GN=AERO2 PE=1 SV=1 44 423 1.0E-82
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 62 425 2.0E-81
sp|Q9C7S7|ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana GN=AERO1 PE=1 SV=1 55 444 1.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEY9|ERO1_NEUCR Endoplasmic reticulum oxidoreductin-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ero-1 PE=3 SV=1 64 463 2.0E-87
sp|Q75BB5|ERO1_ASHGO Endoplasmic reticulum oxidoreductin-1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERO1 PE=3 SV=2 62 425 2.0E-86
sp|Q7X9I4|ERO2_ARATH Endoplasmic reticulum oxidoreductin-2 OS=Arabidopsis thaliana GN=AERO2 PE=1 SV=1 44 423 1.0E-82
sp|Q8NIP5|ERO1_KLULA Endoplasmic reticulum oxidoreductin-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERO1 PE=3 SV=1 62 425 2.0E-81
sp|Q9C7S7|ERO1_ARATH Endoplasmic reticulum oxidoreductin-1 OS=Arabidopsis thaliana GN=AERO1 PE=1 SV=1 55 444 1.0E-79
sp|Q03103|ERO1_YEAST Endoplasmic oxidoreductin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERO1 PE=1 SV=1 64 436 4.0E-79
sp|Q8R2E9|ERO1B_MOUSE ERO1-like protein beta OS=Mus musculus GN=Ero1b PE=1 SV=1 53 424 8.0E-76
sp|Q86YB8|ERO1B_HUMAN ERO1-like protein beta OS=Homo sapiens GN=ERO1B PE=1 SV=2 45 424 2.0E-75
sp|Q9Y7P1|ERO12_SCHPO ERO1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero12 PE=1 SV=2 42 437 8.0E-72
sp|Q9V3A6|ERO1L_DROME Ero1-like protein OS=Drosophila melanogaster GN=Ero1L PE=2 SV=2 53 424 4.0E-71
sp|Q6DD71|ERO1A_XENLA ERO1-like protein alpha OS=Xenopus laevis GN=ero1a PE=2 SV=1 48 425 1.0E-70
sp|Q8R4A1|ERO1A_RAT ERO1-like protein alpha OS=Rattus norvegicus GN=Ero1a PE=1 SV=1 48 424 7.0E-70
sp|A5PJN2|ERO1A_BOVIN ERO1-like protein alpha OS=Bos taurus GN=ERO1A PE=2 SV=1 48 424 2.0E-69
sp|O74401|ERO11_SCHPO ERO1-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ero11 PE=1 SV=1 83 447 2.0E-69
sp|Q8R180|ERO1A_MOUSE ERO1-like protein alpha OS=Mus musculus GN=Ero1a PE=1 SV=2 48 424 7.0E-69
sp|Q96HE7|ERO1A_HUMAN ERO1-like protein alpha OS=Homo sapiens GN=ERO1A PE=1 SV=2 48 424 7.0E-69
sp|B6CVD7|ERO1A_PIG ERO1-like protein alpha OS=Sus scrofa GN=ERO1A PE=2 SV=1 48 424 1.0E-68
sp|B1H1F9|ERO1A_XENTR ERO1-like protein alpha OS=Xenopus tropicalis GN=ero1a PE=2 SV=1 48 424 1.0E-67
sp|Q7T3D1|ERO1A_DANRE ERO1-like protein alpha OS=Danio rerio GN=ero1a PE=2 SV=1 48 382 4.0E-64
sp|Q7YTU4|ERO1_CAEEL Endoplasmic reticulum oxidoreductin-1 OS=Caenorhabditis elegans GN=ero-1 PE=3 SV=2 65 426 3.0E-62
[Show less]

GO

GO Term Description Terminal node
GO:0015035 protein-disulfide reductase activity Yes
GO:0071949 FAD binding Yes
GO:0016972 thiol oxidase activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0034975 protein folding in endoplasmic reticulum Yes
GO:0005575 cellular_component No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0110165 cellular anatomical entity No
GO:0000166 nucleotide binding No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0015036 disulfide oxidoreductase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0043227 membrane-bounded organelle No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006457 protein folding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042930
MRLLLLSPFALLINVSVRAERSFLSDTFVRKDQVQHVMEYEPVKIPSCQNAVLTGPIETTLCDYETVESMNDNLL
SNLSDLVRMPFFRYFQVDLYRQCPFWVDHGSCANEGCAITTVDESDIPEKWRAAALSKVDPDSIDTRHELPGCYY
RDSDYCFLDDNTEGDYYDLQLVPERYTGYSGHDARRIWKSIYEENCFGLSESGLLSGKLPLVSAPDTEQCLEKKV
YYKLISGLHTSISTHICHEYLNQTTGEWGPNLNCFISRVAAYPERLQHLYFNTIVMLRAVARLEPYLAAFDFCSS
GKAEDDVETQDCLSKIVRIAKDAGKFDESALFRGENANVLKEEFKAHFRNVSRIMDCVGCDKCRLWGKIQTTGLA
TALKILFELDENALNPRTNRDFLHRAEMIALFNTLFRFSESIRAVDDFRREWKELDEAESRKLIKETERTTSARP
KPSPHVDEKYRTIPLLTMRLWFSSLFKACQKSTIGDAATGREAVLTPPPLLPVLPRAPSSFSCLANVSVSMIVAN
DDQHKQDSYNGPTVRPPEPAARRRRSFSPLPDYEASEAQYRKSLTVDRKRSWHQSKTWRTILFLLLTYTFLTIVV
GVPIIVTQLRNRQHDDGFPLTDPDLLANQFASSGPGITYTNDLPCNSWNETKLNLAPLLYTATLDMQLPLTGDIS
IRSNATLDETPATKLSGNLLVEYDPNLNSDSAFISVSLHTSTLALREATRVCYSYDGPDRGISIFFPNDMTDDDL
IDMDIRVVFPQSITPTTIPNFNVFLPMFTQNIQDLTKINFGSVNIDGSFRTINVTNIQAPCITVKNMIGDIMGVF
NASETLILDTLKGIVDASITLVKPIYRTTPTKFLLDTGDESINAKISLVSPASDNSLLSSPHFFGTINNFNAPVT
VTFTQPNSSPAIPVRVTIQNSLAATDVVMDQKFEGSFVAQTRLGRVSIDQSDGNSMINPFASDTPRTIVYKEDSA
PSRRSGWISGGKEPPNSQSRVEIYSSLGPIGLHFGPT*
Coding >AgabiH97|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCGTTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTCTGACTGGTCCAATAGAGACCACTCTCTGCGACTATGAGACTGTGGAAAGCATGAACGATAACCTTCTC
AGCAATCTTTCGGACCTCGTCCGTATGCCCTTCTTTCGATATTTCCAGGTCGACCTGTACCGCCAATGTCCGTTC
TGGGTAGATCATGGTTCATGTGCTAATGAAGGCTGCGCTATAACTACCGTCGACGAGAGTGATATACCTGAAAAA
TGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACACGGCATGAATTACCAGGTTGCTACTAC
CGTGACTCGGATTACTGCTTTTTAGATGATAATACTGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGG
TACACCGGTTATTCCGGTCACGATGCGCGGCGGATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCC
GAATCTGGCTTGTTAAGTGGGAAATTACCGCTCGTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTG
TATTATAAGCTTATATCAGGTCTTCACACATCGATATCTACACACATTTGTCACGAGTATCTAAACCAGACGACG
GGCGAATGGGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTAT
TTCAATACTATCGTTATGTTGCGCGCGGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCC
GGAAAAGCCGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAG
TTTGACGAAAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAAT
GTATCCCGTATCATGGACTGTGTAGGCTGTGATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCC
ACCGCGCTCAAGATTTTATTTGAACTCGACGAAAACGCATTAAACCCTAGGACTAATCGAGACTTCCTTCATCGA
GCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGAGAGTATTCGTGCGGTTGATGACTTCCGTCGT
GAATGGAAGGAGTTAGACGAGGCGGAATCCCGGAAGTTGATAAAAGAGACAGAGAGAACTACCAGCGCAAGACCG
AAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGGTTCTCATCGCTG
TTCAAGGCATGTCAGAAAAGCACGATCGGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTC
CTTCCCGTTCTCCCGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAAT
GATGATCAGCACAAGCAAGATTCCTACAATGGTCCCACTGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGT
TCCTTCTCTCCTCTCCCCGATTACGAGGCTTCCGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGG
TCATGGCATCAGTCAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTT
GGCGTACCGATCATCGTAACACAGCTGAGGAACCGACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTA
CTGGCGAACCAATTTGCATCGTCTGGCCCGGGTATAACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAA
ACAAAATTGAACCTCGCTCCTCTATTATATACTGCGACTCTTGATATGCAGTTGCCATTGACGGGTGACATCTCC
ATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGAAATCTTCTTGTGGAATATGACCCC
AATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACCCTAGCTCTCCGCGAAGCAACTCGT
GTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTTTCCCCAACGACATGACGGATGATGACCTG
ATAGACATGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTACCATTCCCAATTTCAATGTATTCCTG
CCAATGTTCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCGG
ACGATCAACGTGACGAATATACAGGCTCCTTGTATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTC
AATGCCTCCGAAACTCTCATTCTGGATACTCTGAAAGGGATAGTCGATGCATCAATAACCCTCGTCAAACCAATA
TACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGAATCTATCAATGCTAAAATATCACTCGTTTCA
CCTGCTTCCGACAATTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCCTGTCACT
GTGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGCAGCGACA
GACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAATTGACCAG
AGCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGATTCGGCA
CCTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGCGTAGAAATCTACTCG
TCTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA
Transcript >AgabiH97|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCGTTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTCTGACTGGTCCAATAGAGACCACTCTCTGCGACTATGAGACTGTGGAAAGCATGAACGATAACCTTCTC
AGCAATCTTTCGGACCTCGTCCGTATGCCCTTCTTTCGATATTTCCAGGTCGACCTGTACCGCCAATGTCCGTTC
TGGGTAGATCATGGTTCATGTGCTAATGAAGGCTGCGCTATAACTACCGTCGACGAGAGTGATATACCTGAAAAA
TGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACACGGCATGAATTACCAGGTTGCTACTAC
CGTGACTCGGATTACTGCTTTTTAGATGATAATACTGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGG
TACACCGGTTATTCCGGTCACGATGCGCGGCGGATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCC
GAATCTGGCTTGTTAAGTGGGAAATTACCGCTCGTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTG
TATTATAAGCTTATATCAGGTCTTCACACATCGATATCTACACACATTTGTCACGAGTATCTAAACCAGACGACG
GGCGAATGGGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTAT
TTCAATACTATCGTTATGTTGCGCGCGGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCC
GGAAAAGCCGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAG
TTTGACGAAAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAAT
GTATCCCGTATCATGGACTGTGTAGGCTGTGATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCC
ACCGCGCTCAAGATTTTATTTGAACTCGACGAAAACGCATTAAACCCTAGGACTAATCGAGACTTCCTTCATCGA
GCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGAGAGTATTCGTGCGGTTGATGACTTCCGTCGT
GAATGGAAGGAGTTAGACGAGGCGGAATCCCGGAAGTTGATAAAAGAGACAGAGAGAACTACCAGCGCAAGACCG
AAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGGTTCTCATCGCTG
TTCAAGGCATGTCAGAAAAGCACGATCGGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTC
CTTCCCGTTCTCCCGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAAT
GATGATCAGCACAAGCAAGATTCCTACAATGGTCCCACTGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGT
TCCTTCTCTCCTCTCCCCGATTACGAGGCTTCCGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGG
TCATGGCATCAGTCAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTT
GGCGTACCGATCATCGTAACACAGCTGAGGAACCGACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTA
CTGGCGAACCAATTTGCATCGTCTGGCCCGGGTATAACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAA
ACAAAATTGAACCTCGCTCCTCTATTATATACTGCGACTCTTGATATGCAGTTGCCATTGACGGGTGACATCTCC
ATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGAAATCTTCTTGTGGAATATGACCCC
AATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACCCTAGCTCTCCGCGAAGCAACTCGT
GTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTTTCCCCAACGACATGACGGATGATGACCTG
ATAGACATGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTACCATTCCCAATTTCAATGTATTCCTG
CCAATGTTCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCGG
ACGATCAACGTGACGAATATACAGGCTCCTTGTATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTC
AATGCCTCCGAAACTCTCATTCTGGATACTCTGAAAGGGATAGTCGATGCATCAATAACCCTCGTCAAACCAATA
TACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGAATCTATCAATGCTAAAATATCACTCGTTTCA
CCTGCTTCCGACAATTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCCTGTCACT
GTGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGCAGCGACA
GACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAATTGACCAG
AGCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGATTCGGCA
CCTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGCGTAGAAATCTACTCG
TCTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA
Gene >AgabiH97|042930
ATGAGACTCCTTCTCCTCTCCCCCTTCGCCTTACTCATCAACGTCTCAGTGAGGGCCGAGAGATCGTTTCTGTCA
GATACCTTTGTTAGGAAGGATCAGGTCCAACATGTTATGGAATATGAACCAGTCAAAATCCCTTCTTGTCAAAAC
GCTGTTGTGAGTTTTTCCAACCAATCTACGGTCCCCGCACTGCTCACACGCTGCTTCTTAGCTGACTGGTCCAAT
AGAGACCACTCTCTGCGACTATGAGACTGTGGAAAGCATGAACGATAACCTTCTCAGCAATCTTTCGGACCTCGT
CCGTATGCCCTTCTTTCGATATTTCCAGGTGGGATCCATCCTTGTGACCCCTCTCTCTATGGCTAATAAATCCCA
AGGTCGACCTGTACCGCCAATGTCCGTTCTGGGTAGATCATGGTTCATGTGCTAATGAAGGCTGCGCTATAACTA
CCGTCGACGAGGTCAGCTCGCGCCACTTCGGCAACCCGAACACTACTAAGCGCTTATCAAATTAGAGTGATATAC
CTGAAAAATGGAGGGCTGCGGCTTTAAGCAAAGTGGACCCTGATTCAATTGACACAGTAGGTTTAAATCATCATC
TGTGAAAATGATATGATTGATCCCGCCACGCTTACCTCTAGCGGCATGAATTACCAGGTTGCTACTACCGTGACT
CGGATTACTGCTTTTTAGATGATAATACTGGTACGTGCTCCCACATCTCGTTCAGGTTACCCCTCTAATGAGTCA
CATAGAGGGGGATTACTACGACCTCCAACTGGTTCCGGAAAGGTACACCGGTTATTCCGGTCACGATGCGCGGCG
GATATGGAAGTCCATCTATGAAGAGAACTGCTTCGGTTTATCCGAATCTGGCTTGTTAAGTGGGAAATTACCGCT
CGTATCAGCACCCGATACAGAGCAATGTCTTGAAAAGAAAGTGTATTATAAGCTTATATCAGGTATGCTTTCGTT
TCAGTTGGCGGTTGATATCATAGCTCAATTCGCACAAGGTCTTCACACATCGATATCTACACACATTTGTCACGA
GTATCTAAACCAGACGACGGGCGAATGGGTAAGTCCGAATATTTGCAGTCGGATGATCCGTTTGACCATTGATTT
TGATACAGGGACCAAATCTGAATTGTTTCATATCTCGCGTCGCAGCATATCCCGAGCGCCTGCAACACCTGTATT
TCAATACTATCGTTATGTTGCGCGCGGTCGCTCGTCTCGAACCATACCTCGCGGCCTTTGACTTTTGCTCTTCCG
GAAAAGCCGAGGACGACGTTGAGACCCAGGATTGTCTATCCAAGATTGTTCGCATTGCCAAAGATGCTGGAAAGT
TTGACGAAAGTGCCTTATTCAGAGGTGAAAATGCGAATGTTGGTCCCTTTTTCTTCGATTACAGATCAAAACAAT
GACGTTAGGAGCCAGGTTCTCAAGGAAGAGTTCAAAGCCCACTTCAGAAATGTATCCCGTATCATGGACTGTGTA
GGCTGTGATAAGTGCAGACTTTGGGGCAAGATTCAGACAACGGGACTCGCCACCGCGCTCAAGATTTTATTTGAA
CTCGACGAAAACGCATTAAAGTGAGTGGCGGCTTCGAACTTGCCATATATGTTTTGGTTTGTGACAAGTTTTTAG
CCCTAGGACTAATCGAGACTTCCTTCATCGAGCCGAAATGATCGCATTATTCAATACTCTCTTTCGGTTTAGCGA
GAGTATTCGTGCGGTTGATGACTTCCGTCGTGAATGGAAGGAGTTAGACGAGGCGGAATCCCGGAAGTTGATAAA
AGAGACAGAGAGAACTACCAGCGCAAGAGTAGGTCGAAACCATGACGAATTCTAGTGGCATTCAGACATCTAACG
GGACTATAGCCGAAACCGTCTCCCCATGTAGACGAGAAGTACCGGACGATCCCGCTGCTGACGATGAGACTCTGG
TTCTCATCGCTGTTCAAGGCATGTCAGAAAAGCACGATCGGGTGTGCGGGAGCGGTATGGGACACGTTGCGGAGT
TGGATGGGACAGACGTTCACTCTGTTCGAGAAGTTCAATCTGCACAAAGAACGCGGGCCTGGAGCCAATTATGGG
GAACTCTGAGAGAGTATGGACAGTAGGGACACGTATGATAGATTAATTGTATTTTTGGACGGGAAAGTGCGAGGA
TGACTAAGTGTTACGCTGGTCAGAGATGCAGCAACCGGGCGCGAGGCCGTCTTGACTCCGCCACCTCTCCTTCCC
GTTCTCCCGCGGGCTCCCTCTTCGTTCTCCTGTCTTGCCAATGTGTCGGTGAGCATGATCGTAGCCAATGATGAT
CAGCACAAGCAAGATTCCTACAATGGTCCCACTGTTCGTCCCCCGGAGCCCGCTGCCCGACGAAGACGTTCCTTC
TCTCCTCTCCCCGATTACGAGGCTTCCGAGGCACAATACCGGAAGAGCCTTACTGTGGATCGTAAAAGGTCATGG
CATCAGTCAAAGACGTGGAGAACCATTCTCTTCCTCCTGTTGACGTACACTTTCTTAACGATCGTCGTTGGCGTA
CCGATCATCGTAACAGTGAGTCAACCCGCTTCCCTCCAAAAGGCAAACAATGGCTGATATGTAACCCAGCAGCTG
AGGAACCGACAACATGACGACGGTTTTCCACTGACCGACCCAGATCTACTGGCGAACCAATTTGCATCGTCTGGC
CCGGGTATAACCTATACCAACGACTTGCCTTGTAACAGTTGGAATGAAACAAAATTGAACCTCGCTCCTCTATTA
TATACTGCGACGTACGTGTCCATCATCAATCTTATCTGCGTCGTGCTAAGAGTGTTGTCTAGTCTTGATATGCAG
TTGCCATTGACGGGTGACATCTCCATTCGTTCCAATGCCACCCTCGATGAAACACCTGCCACCAAACTTTCTGGA
AATCTTCTTGTGGAATATGACCCCAATCTCAACAGTGACAGTGCTTTCATTTCTGTGAGCCTACACACGTCTACC
CTAGCTCTCCGCGAAGCAACTCGTGTTTGTTATTCTTACGATGGTCCTGATCGTGGAATCTCCATATTTGTGCGA
TTATCTCTATTGTCCTGAAAGAATCAACTCATAATATGTATTGTAGTTCCCCAACGACATGACGGATGATGACCT
GATAGACATGGACATCCGAGTCGTTTTCCCACAATCTATCACACCCACTACCATTCCCAATTTCAATGTATTCCT
GCCAATGTTCACGCAGAACATTCAAGATTTGACAAAAATTAACTTTGGCTCAGTCAATATTGACGGGTCCTTCCG
GACGATCAACGTGACGGTATGCCCCTCCGTGTTGCATGTTCGACGTACATTAACTCTGGGTGTAGAATATACAGG
CTCCTTGTATAACTGTCAAGAACATGATAGGAGACATAATGGGAGTGTTCAATGCCTCCGAAACTCTCATTCTGG
ATACTCTGAAAGGGTAATCATAAATCTGACGACTACGAAGAAAATTACTTATCACTCCAATTCATCCAGGATAGT
CGATGCATCAATAACCCTCGTCAAACCAATATACCGCACCACTCCAACAAAATTCCTATTGGATACTGGTGATGA
GTAAGTGAAGTCATTTTCGTTCTTGATTCTGTTCTCATTCACGTGAATCAGATCTATCAATGCTAAAATATCACT
CGTTTCACCTGCTTCCGACAATTCTTTGTTATCCTCCCCGCATTTCTTCGGCACAATAAACAACTTCAATGCGCC
TGTCACTGTGACATTCACCCAACCCAACTCCTCACCTGCCATACCTGTGCGCGTCACAATACAGAATAGCTTGGC
AGCGACAGACGTGGTTATGGACCAGAAGTTCGAAGGTTCCTTTGTTGCGCAGACAAGGCTCGGTCGTGTATCAAT
TGACCAGAGCGACGGAAATTCGATGATAAATCCTTTTGCATCAGATACACCACGGACAATCGTTTACAAGGAAGA
TTCGGCACCTTCAAGAAGAAGTGGCTGGATCAGTGGGGGGAAAGAGCCTCCAAACAGTCAGAGTCGCGTAGAAAT
CTACTCGTCTCTAGGACCTATTGGCTTACACTTTGGACCGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail