Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042870
Gene name
Locationscaffold_2:1095603..1097741
Strand+
Gene length (bp)2138
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01747 ATP-sulfurylase ATP-sulfurylase 9.5E-86 175 388
PF14306 PUA_2 PUA-like domain 6.0E-51 4 165
PF01583 APS_kinase Adenylylsulphate kinase 8.1E-51 396 556

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P460|MET3_USTMA Sulfate adenylyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q8TG24|MET3_CRYNH Sulfate adenylyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=MET3 PE=2 SV=1 1 575 0.0E+00
sp|Q4WWN8|MET3_ASPFU Sulfate adenylyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|A1D858|MET3_NEOFI Sulfate adenylyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|P0CN04|MET3_CRYNJ Sulfate adenylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MET3 PE=3 SV=1 1 575 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P460|MET3_USTMA Sulfate adenylyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q8TG24|MET3_CRYNH Sulfate adenylyltransferase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=MET3 PE=2 SV=1 1 575 0.0E+00
sp|Q4WWN8|MET3_ASPFU Sulfate adenylyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|A1D858|MET3_NEOFI Sulfate adenylyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|P0CN04|MET3_CRYNJ Sulfate adenylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|P0CN05|MET3_CRYNB Sulfate adenylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q6CFD2|MET3_YARLI Sulfate adenylyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|A1CJC1|MET3_ASPCL Sulfate adenylyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|Q0V6P9|MET3_PHANO Sulfate adenylyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q1EAF9|MET3_COCIM Sulfate adenylyltransferase OS=Coccidioides immitis (strain RS) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q8NJN1|MET3_ASPNG Sulfate adenylyltransferase OS=Aspergillus niger GN=met3 PE=3 SV=1 1 572 0.0E+00
sp|Q0CC19|MET3_ASPTN Sulfate adenylyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=met3 PE=3 SV=1 1 572 0.0E+00
sp|Q7SE75|MET3_NEUCR Sulfate adenylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|Q12555|MET3_EMENI Sulfate adenylyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|Q2H454|MET3_CHAGB Sulfate adenylyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MET3 PE=3 SV=1 1 575 0.0E+00
sp|Q8NK83|MET3_ASPOR Sulfate adenylyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=met3 PE=3 SV=1 1 575 0.0E+00
sp|Q12650|MET3_PENCH Sulfate adenylyltransferase OS=Penicillium chrysogenum GN=met3 PE=1 SV=1 1 575 0.0E+00
sp|P56862|MET3_ASPTE Sulfate adenylyltransferase OS=Aspergillus terreus GN=met3 PE=3 SV=1 1 572 0.0E+00
sp|Q8J0I4|MET3_MUCCL Sulfate adenylyltransferase OS=Mucor circinelloides f. lusitanicus GN=MET3 PE=3 SV=1 1 570 0.0E+00
sp|Q4I1N3|MET3_GIBZE Sulfate adenylyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MET3 PE=3 SV=2 1 575 0.0E+00
sp|P78937|MET3_SCHPO Sulfate adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sua1 PE=1 SV=2 8 495 0.0E+00
sp|P08536|MET3_YEAST Sulfate adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET3 PE=1 SV=2 4 426 7.0E-177
sp|Q6FXQ8|MET3_CANGA Sulfate adenylyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MET3 PE=3 SV=1 4 426 7.0E-174
sp|Q74ZF6|MET3_ASHGO Sulfate adenylyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MET3 PE=3 SV=1 4 426 1.0E-173
sp|Q6CNU6|MET3_KLULA Sulfate adenylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MET3 PE=3 SV=1 4 426 2.0E-173
sp|Q9Y872|MET3_CANAL Sulfate adenylyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET3 PE=3 SV=2 4 480 8.0E-169
sp|Q6BSU5|MET3_DEBHA Sulfate adenylyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MET3 PE=3 SV=1 4 474 1.0E-166
sp|O67174|SATC_AQUAE Probable bifunctional SAT/APS kinase OS=Aquifex aeolicus (strain VF5) GN=sat/cysC PE=1 SV=1 26 575 1.0E-161
sp|B9DLL5|SAT_STACT Sulfate adenylyltransferase OS=Staphylococcus carnosus (strain TM300) GN=sat PE=3 SV=1 2 386 4.0E-87
sp|Q49UM4|SAT_STAS1 Sulfate adenylyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sat PE=3 SV=1 5 386 1.0E-83
sp|Q8EQN5|SAT_OCEIH Sulfate adenylyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=sat PE=3 SV=1 5 386 4.0E-83
sp|Q67QB5|SAT_SYMTH Sulfate adenylyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=sat PE=3 SV=1 4 389 2.0E-81
sp|Q4L9E7|SAT_STAHJ Sulfate adenylyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sat PE=3 SV=1 5 386 6.0E-81
sp|B9LKB9|SAT_CHLSY Sulfate adenylyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=sat PE=3 SV=1 4 390 2.0E-80
sp|A9WFJ2|SAT_CHLAA Sulfate adenylyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=sat PE=3 SV=1 4 390 2.0E-80
sp|Q5HL01|SAT_STAEQ Sulfate adenylyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sat PE=3 SV=1 5 386 9.0E-80
sp|A9ENT2|SATC1_SORC5 Probable bifunctional SAT/APS kinase 1 OS=Sorangium cellulosum (strain So ce56) GN=sat1/cysC1 PE=3 SV=1 5 386 1.0E-79
sp|Q8CR03|SAT_STAES Sulfate adenylyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sat PE=3 SV=1 5 386 3.0E-79
sp|A9G7W0|SATC2_SORC5 Probable bifunctional SAT/APS kinase 2 OS=Sorangium cellulosum (strain So ce56) GN=sat2/cysC2 PE=3 SV=1 4 389 1.0E-76
sp|A5D5R7|SAT_PELTS Sulfate adenylyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=sat PE=3 SV=1 1 390 1.0E-76
sp|O06736|SAT2_BACSU Probable sulfate adenylyltransferase OS=Bacillus subtilis (strain 168) GN=yitA PE=3 SV=2 2 386 1.0E-75
sp|B1HXC8|SAT_LYSSC Sulfate adenylyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=sat PE=3 SV=1 1 386 2.0E-75
sp|C0QSU0|SAT_PERMH Sulfate adenylyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=sat PE=3 SV=1 4 386 5.0E-75
sp|A0RBN3|SAT_BACAH Sulfate adenylyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=sat PE=3 SV=1 18 386 5.0E-74
sp|B7INB5|SAT_BACC2 Sulfate adenylyltransferase OS=Bacillus cereus (strain G9842) GN=sat PE=3 SV=1 22 386 6.0E-74
sp|A9BFU2|SAT_PETMO Sulfate adenylyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=sat PE=3 SV=1 5 390 8.0E-74
sp|B7HHH7|SAT_BACC4 Sulfate adenylyltransferase OS=Bacillus cereus (strain B4264) GN=sat PE=3 SV=1 22 386 2.0E-73
sp|Q63DV8|SAT_BACCZ Sulfate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=sat PE=3 SV=1 18 386 3.0E-73
sp|Q6HLD3|SAT_BACHK Sulfate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=sat PE=3 SV=1 34 386 5.0E-73
sp|Q81FZ0|SAT_BACCR Sulfate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=sat PE=3 SV=1 9 386 6.0E-73
sp|Q1IYH9|SAT_DEIGD Sulfate adenylyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=sat PE=3 SV=1 27 390 9.0E-73
sp|A9VLJ0|SAT_BACWK Sulfate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=sat PE=3 SV=1 26 386 2.0E-72
sp|B9IV12|SAT_BACCQ Sulfate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=sat PE=3 SV=1 41 386 2.0E-72
sp|B7HKE6|SAT_BACC7 Sulfate adenylyltransferase OS=Bacillus cereus (strain AH187) GN=sat PE=3 SV=1 41 386 2.0E-72
sp|B7JGQ4|SAT_BACC0 Sulfate adenylyltransferase OS=Bacillus cereus (strain AH820) GN=sat PE=3 SV=1 18 386 6.0E-72
sp|C1EMR9|SAT_BACC3 Sulfate adenylyltransferase OS=Bacillus cereus (strain 03BB102) GN=sat PE=3 SV=1 18 386 6.0E-72
sp|A7GMW1|SAT_BACCN Sulfate adenylyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=sat PE=3 SV=1 26 386 7.0E-72
sp|Q5L2Y0|SAT_GEOKA Sulfate adenylyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=sat PE=3 SV=1 5 386 8.0E-72
sp|Q88X61|SAT_LACPL Sulfate adenylyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=sat PE=3 SV=1 6 396 9.0E-72
sp|A7Z4H9|SAT_BACMF Sulfate adenylyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=sat PE=3 SV=1 1 397 3.0E-71
sp|A4IKB5|SAT_GEOTN Sulfate adenylyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=sat PE=3 SV=1 5 386 3.0E-71
sp|C5D5A6|SAT_GEOSW Sulfate adenylyltransferase OS=Geobacillus sp. (strain WCH70) GN=sat PE=3 SV=1 5 386 3.0E-71
sp|A8FD24|SAT_BACP2 Sulfate adenylyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=sat PE=3 SV=1 1 388 5.0E-71
sp|Q73B75|SAT_BACC1 Sulfate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=sat PE=3 SV=1 41 386 5.0E-71
sp|B3ELG8|SAT_CHLPB Sulfate adenylyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=sat PE=3 SV=1 4 390 5.0E-71
sp|B1I3M7|SAT_DESAP Sulfate adenylyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=sat PE=3 SV=1 30 390 6.0E-71
sp|Q2JU97|SAT_SYNJA Sulfate adenylyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=sat PE=3 SV=1 2 389 1.0E-70
sp|Q65JT9|SAT_BACLD Sulfate adenylyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=sat PE=3 SV=1 1 386 2.0E-70
sp|Q81T48|SAT_BACAN Sulfate adenylyltransferase OS=Bacillus anthracis GN=sat PE=3 SV=1 18 386 2.0E-70
sp|C3L9N5|SAT_BACAC Sulfate adenylyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=sat PE=3 SV=1 18 386 2.0E-70
sp|C3P517|SAT_BACAA Sulfate adenylyltransferase OS=Bacillus anthracis (strain A0248) GN=sat PE=3 SV=1 18 386 2.0E-70
sp|Q1AXE5|SAT_RUBXD Sulfate adenylyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=sat PE=3 SV=1 4 386 3.0E-70
sp|C1CVW9|SAT_DEIDV Sulfate adenylyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=sat PE=3 SV=1 4 390 1.0E-69
sp|O34764|SAT1_BACSU Sulfate adenylyltransferase OS=Bacillus subtilis (strain 168) GN=sat PE=2 SV=1 1 386 2.0E-69
sp|Q3MAI6|SAT_ANAVT Sulfate adenylyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=sat PE=3 SV=1 2 378 2.0E-69
sp|B7JVS6|SAT_CYAP8 Sulfate adenylyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=sat PE=3 SV=1 4 386 4.0E-69
sp|P56864|SAT_DEIRA Sulfate adenylyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=sat PE=3 SV=1 4 390 1.0E-68
sp|Q111K4|SAT_TRIEI Sulfate adenylyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=sat PE=3 SV=1 6 378 1.0E-68
sp|B0JW81|SAT_MICAN Sulfate adenylyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=sat PE=3 SV=1 4 378 2.0E-68
sp|B8D0S5|SAT_HALOH Sulfate adenylyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=sat PE=3 SV=1 4 386 4.0E-68
sp|Q5WKF4|SAT_BACSK Sulfate adenylyltransferase OS=Bacillus clausii (strain KSM-K16) GN=sat PE=3 SV=1 27 386 6.0E-68
sp|Q5N2R3|SAT_SYNP6 Sulfate adenylyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=sat PE=3 SV=1 4 378 1.0E-67
sp|Q31RJ2|SAT_SYNE7 Sulfate adenylyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=sat PE=3 SV=1 4 378 1.0E-67
sp|B0BZ94|SAT_ACAM1 Sulfate adenylyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=sat PE=3 SV=1 2 386 2.0E-67
sp|B1XLP7|SAT_SYNP2 Sulfate adenylyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=sat PE=3 SV=1 4 378 8.0E-67
sp|Q7NLN7|SAT_GLOVI Sulfate adenylyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=sat PE=3 SV=1 4 397 1.0E-66
sp|B4SAM9|SAT_PELPB Sulfate adenylyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=sat PE=3 SV=1 4 390 1.0E-66
sp|Q8KE30|SAT_CHLTE Sulfate adenylyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=sat PE=3 SV=1 4 390 3.0E-66
sp|Q3AQ83|SAT_CHLCH Sulfate adenylyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=sat PE=3 SV=1 4 390 2.0E-65
sp|B2J5M3|SAT_NOSP7 Sulfate adenylyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sat PE=3 SV=1 2 378 2.0E-65
sp|A3DLD9|SAT_STAMF Sulfate adenylyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=sat PE=3 SV=1 1 386 2.0E-64
sp|A4J272|SAT_DESRM Sulfate adenylyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=sat PE=3 SV=1 5 390 1.0E-62
sp|O76156|SAT_ENTHI Sulfate adenylyltransferase OS=Entamoeba histolytica PE=3 SV=1 5 390 2.0E-62
sp|P74241|SAT_SYNY3 Sulfate adenylyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sat PE=3 SV=1 2 386 6.0E-62
sp|Q3A8R0|SAT_CARHZ Sulfate adenylyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=sat PE=3 SV=1 17 390 2.0E-61
sp|Q1QAY1|SAT_PSYCK Sulfate adenylyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=sat PE=3 SV=1 5 390 1.0E-60
sp|Q4FST7|SAT_PSYA2 Sulfate adenylyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=sat PE=3 SV=2 5 390 2.0E-60
sp|A5WEH0|SAT_PSYWF Sulfate adenylyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=sat PE=3 SV=1 5 390 4.0E-60
sp|A9A541|SAT_NITMS Sulfate adenylyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=sat PE=3 SV=1 5 370 6.0E-60
sp|Q3SEZ6|SAT_THIDA Sulfate adenylyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=sat PE=3 SV=1 5 390 8.0E-60
sp|B8J4A8|SAT_DESDA Sulfate adenylyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=sat PE=3 SV=1 4 390 1.0E-59
sp|A2BMW0|SAT_HYPBU Sulfate adenylyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=sat PE=3 SV=1 1 386 2.0E-59
sp|A1AVC7|SAT_RUTMC Sulfate adenylyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=sat PE=3 SV=1 5 390 1.0E-57
sp|A5CXS6|SAT_VESOH Sulfate adenylyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=sat PE=3 SV=1 5 390 1.0E-57
sp|A8AB48|SAT_IGNH4 Sulfate adenylyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=sat PE=3 SV=1 1 386 2.0E-57
sp|P56863|SAT_PYRAB Sulfate adenylyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=sat PE=3 SV=1 1 387 3.0E-57
sp|B8FB52|SAT_DESAA Sulfate adenylyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=sat PE=3 SV=1 5 390 7.0E-57
sp|Q9YCR4|SAT_AERPE Sulfate adenylyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=sat PE=3 SV=2 1 377 7.0E-57
sp|A0RYU6|SAT_CENSY Sulfate adenylyltransferase OS=Cenarchaeum symbiosum (strain A) GN=sat PE=3 SV=1 5 388 9.0E-56
sp|A0LH38|SAT_SYNFM Sulfate adenylyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=sat PE=3 SV=1 30 390 4.0E-55
sp|B6YUW9|SAT_THEON Sulfate adenylyltransferase OS=Thermococcus onnurineus (strain NA1) GN=sat PE=3 SV=1 1 392 1.0E-53
sp|O66036|SAT_ALLVD Sulfate adenylyltransferase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=sat PE=1 SV=1 24 390 1.0E-50
sp|Q0VRM0|SAT_ALCBS Sulfate adenylyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=sat PE=3 SV=1 16 390 1.0E-47
sp|Q43870|APS2_ARATH ATP sulfurylase 2 OS=Arabidopsis thaliana GN=APS2 PE=1 SV=1 5 390 4.0E-35
sp|A6TD42|CYSC_KLEP7 Adenylyl-sulfate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysC PE=3 SV=1 396 575 1.0E-34
sp|B5XV31|CYSC_KLEP3 Adenylyl-sulfate kinase OS=Klebsiella pneumoniae (strain 342) GN=cysC PE=3 SV=1 396 575 1.0E-34
sp|O23324|APS3_ARATH ATP-sulfurylase 3, chloroplastic OS=Arabidopsis thaliana GN=APS3 PE=1 SV=1 5 390 2.0E-34
sp|Q9LIK9|APS1_ARATH ATP sulfurylase 1, chloroplastic OS=Arabidopsis thaliana GN=APS1 PE=1 SV=1 4 390 2.0E-34
sp|P29811|CYSC_PSEAI Probable adenylyl-sulfate kinase OS=Pseudomonas aeruginosa PE=3 SV=1 397 566 6.0E-34
sp|Q07Y94|CYSC_SHEFN Adenylyl-sulfate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysC PE=3 SV=1 399 575 1.0E-33
sp|Q60FC6|SAT_PYRYE Sulfate adenylyltransferase OS=Pyropia yezoensis GN=atps PE=1 SV=3 1 396 2.0E-33
sp|A4WDV5|CYSC_ENT38 Adenylyl-sulfate kinase OS=Enterobacter sp. (strain 638) GN=cysC PE=3 SV=1 396 575 7.0E-33
sp|A1U3X8|CYSC_MARHV Adenylyl-sulfate kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysC PE=3 SV=1 384 575 6.0E-32
sp|B7LWK5|CYSC_ESCF3 Adenylyl-sulfate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysC PE=3 SV=1 376 575 1.0E-31
sp|Q88X60|CYSC_LACPL Adenylyl-sulfate kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysC PE=3 SV=1 394 569 1.0E-31
sp|Q13ZJ7|CYSC_BURXL Adenylyl-sulfate kinase OS=Burkholderia xenovorans (strain LB400) GN=cysC PE=3 SV=1 396 566 2.0E-31
sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1 27 396 3.0E-31
sp|Q97MT8|CYSC_CLOAB Adenylyl-sulfate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysC PE=3 SV=1 383 575 3.0E-31
sp|A5N960|CYSC_CLOK5 Adenylyl-sulfate kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysC PE=3 SV=1 395 572 5.0E-31
sp|B8D0S4|CYSC_HALOH Adenylyl-sulfate kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=cysC PE=3 SV=1 393 575 5.0E-31
sp|B2TZI1|CYSC_SHIB3 Adenylyl-sulfate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysC PE=3 SV=1 376 575 8.0E-31
sp|Q3YYB2|CYSC_SHISS Adenylyl-sulfate kinase OS=Shigella sonnei (strain Ss046) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|Q0T1I1|CYSC_SHIF8 Adenylyl-sulfate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|Q32CI0|CYSC_SHIDS Adenylyl-sulfate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|Q31XB2|CYSC_SHIBS Adenylyl-sulfate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B1LQ71|CYSC_ECOSM Adenylyl-sulfate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B6I6E0|CYSC_ECOSE Adenylyl-sulfate kinase OS=Escherichia coli (strain SE11) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B7N6Y0|CYSC_ECOLU Adenylyl-sulfate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|P0A6J1|CYSC_ECOLI Adenylyl-sulfate kinase OS=Escherichia coli (strain K12) GN=cysC PE=1 SV=2 376 575 9.0E-31
sp|A8A3M9|CYSC_ECOHS Adenylyl-sulfate kinase OS=Escherichia coli O9:H4 (strain HS) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B1XCS6|CYSC_ECODH Adenylyl-sulfate kinase OS=Escherichia coli (strain K12 / DH10B) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|C4ZZQ4|CYSC_ECOBW Adenylyl-sulfate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B7LXG2|CYSC_ECO8A Adenylyl-sulfate kinase OS=Escherichia coli O8 (strain IAI1) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|B5Z3B2|CYSC_ECO5E Adenylyl-sulfate kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|P0A6J2|CYSC_ECO57 Adenylyl-sulfate kinase OS=Escherichia coli O157:H7 GN=cysC PE=3 SV=2 376 575 9.0E-31
sp|B7LEG8|CYSC_ECO55 Adenylyl-sulfate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|A7ZQJ4|CYSC_ECO24 Adenylyl-sulfate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysC PE=3 SV=1 376 575 9.0E-31
sp|Q2JUC0|CYSC_SYNJA Adenylyl-sulfate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysC PE=3 SV=1 395 575 1.0E-30
sp|P57702|CYSC_PSEAE Adenylyl-sulfate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysC PE=3 SV=1 399 572 1.0E-30
sp|B0TTD2|CYSC_SHEHH Adenylyl-sulfate kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysC PE=3 SV=1 398 571 1.0E-30
sp|Q1R7U1|CYSC_ECOUT Adenylyl-sulfate kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|Q8FEJ2|CYSC_ECOL6 Adenylyl-sulfate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysC PE=3 SV=3 396 575 1.0E-30
sp|A1AEU4|CYSC_ECOK1 Adenylyl-sulfate kinase OS=Escherichia coli O1:K1 / APEC GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|B7MYQ5|CYSC_ECO81 Adenylyl-sulfate kinase OS=Escherichia coli O81 (strain ED1a) GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|B7NT94|CYSC_ECO7I Adenylyl-sulfate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|B7MKM4|CYSC_ECO45 Adenylyl-sulfate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|B7UHG9|CYSC_ECO27 Adenylyl-sulfate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysC PE=3 SV=1 396 575 1.0E-30
sp|P72940|CYSC_SYNY3 Probable adenylyl-sulfate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysC PE=1 SV=1 394 565 1.0E-30
sp|P63889|CYSC_SALTY Adenylyl-sulfate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysC PE=3 SV=2 376 575 2.0E-30
sp|P63890|CYSC_SALTI Adenylyl-sulfate kinase OS=Salmonella typhi GN=cysC PE=3 SV=2 376 575 2.0E-30
sp|B4TTW4|CYSC_SALSV Adenylyl-sulfate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|A9N2D7|CYSC_SALPB Adenylyl-sulfate kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B4T460|CYSC_SALNS Adenylyl-sulfate kinase OS=Salmonella newport (strain SL254) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B4TFX0|CYSC_SALHS Adenylyl-sulfate kinase OS=Salmonella heidelberg (strain SL476) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B5QW21|CYSC_SALEP Adenylyl-sulfate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B5FTS8|CYSC_SALDC Adenylyl-sulfate kinase OS=Salmonella dublin (strain CT_02021853) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B5F414|CYSC_SALA4 Adenylyl-sulfate kinase OS=Salmonella agona (strain SL483) GN=cysC PE=3 SV=1 376 575 2.0E-30
sp|B1IUS9|CYSC_ECOLC Adenylyl-sulfate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysC PE=3 SV=1 376 575 3.0E-30
sp|B2VG00|CYSC_ERWT9 Adenylyl-sulfate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysC PE=3 SV=1 396 575 3.0E-30
sp|A8H0A6|CYSC_SHEPA Adenylyl-sulfate kinase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysC PE=3 SV=1 398 571 3.0E-30
sp|C0PXB0|CYSC_SALPC Adenylyl-sulfate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=cysC PE=3 SV=1 376 575 3.0E-30
sp|Q57KJ1|CYSC_SALCH Adenylyl-sulfate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=cysC PE=3 SV=1 376 575 3.0E-30
sp|Q2JLM3|CYSC_SYNJB Adenylyl-sulfate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysC PE=3 SV=1 395 572 3.0E-30
sp|B5RDQ6|CYSC_SALG2 Adenylyl-sulfate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysC PE=3 SV=1 376 575 3.0E-30
sp|B5BEY7|CYSC_SALPK Adenylyl-sulfate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysC PE=3 SV=1 376 575 4.0E-30
sp|Q5PEH3|CYSC_SALPA Adenylyl-sulfate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysC PE=3 SV=1 376 575 4.0E-30
sp|Q0TEA8|CYSC_ECOL5 Adenylyl-sulfate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysC PE=3 SV=1 396 575 4.0E-30
sp|A7MJ70|CYSC_CROS8 Adenylyl-sulfate kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysC PE=3 SV=1 396 575 4.0E-30
sp|B7K5B1|CYSC_CYAP8 Adenylyl-sulfate kinase OS=Cyanothece sp. (strain PCC 8801) GN=cysC PE=3 SV=1 394 570 8.0E-30
sp|Q83JX9|CYSC_SHIFL Adenylyl-sulfate kinase OS=Shigella flexneri GN=cysC PE=3 SV=1 376 575 8.0E-30
sp|A8ANW4|CYSC_CITK8 Adenylyl-sulfate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysC PE=3 SV=1 385 569 9.0E-30
sp|Q9S7D8|APS4_ARATH ATP sulfurylase 4, chloroplastic OS=Arabidopsis thaliana GN=APS4 PE=2 SV=1 5 390 9.0E-30
sp|Q8ZBP3|CYSC_YERPE Adenylyl-sulfate kinase OS=Yersinia pestis GN=cysC PE=3 SV=1 385 575 1.0E-29
sp|B1XN05|CYSC_SYNP2 Adenylyl-sulfate kinase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysC PE=3 SV=1 396 566 1.0E-29
sp|Q7VE24|CYSC_PROMA Adenylyl-sulfate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysC PE=3 SV=1 385 566 2.0E-29
sp|A0KTI5|CYSC_SHESA Adenylyl-sulfate kinase OS=Shewanella sp. (strain ANA-3) GN=cysC PE=3 SV=1 399 571 3.0E-29
sp|Q8EB13|CYSC_SHEON Adenylyl-sulfate kinase OS=Shewanella oneidensis (strain MR-1) GN=cysC PE=3 SV=1 399 571 3.0E-29
sp|Q12QM6|CYSC_SHEDO Adenylyl-sulfate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysC PE=3 SV=1 399 571 3.0E-29
sp|Q7MPF0|CYSC_VIBVY Adenylyl-sulfate kinase OS=Vibrio vulnificus (strain YJ016) GN=cysC PE=3 SV=1 376 574 3.0E-29
sp|Q8DE75|CYSC_VIBVU Adenylyl-sulfate kinase OS=Vibrio vulnificus (strain CMCP6) GN=cysC PE=3 SV=1 376 574 3.0E-29
sp|Q0HFM7|CYSC_SHESM Adenylyl-sulfate kinase OS=Shewanella sp. (strain MR-4) GN=cysC PE=3 SV=1 399 571 5.0E-29
sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=2 22 390 5.0E-29
sp|B2T3K5|CYSC_BURPP Adenylyl-sulfate kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=cysC PE=3 SV=1 395 571 6.0E-29
sp|Q0HYA3|CYSC_SHESR Adenylyl-sulfate kinase OS=Shewanella sp. (strain MR-7) GN=cysC PE=3 SV=1 399 571 6.0E-29
sp|A9MF25|CYSC_SALAR Adenylyl-sulfate kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysC PE=3 SV=1 396 575 7.0E-29
sp|A6WJU6|CYSC_SHEB8 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS185) GN=cysC PE=3 SV=1 399 575 7.0E-29
sp|B8EE63|CYSC_SHEB2 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS223) GN=cysC PE=3 SV=1 399 575 7.0E-29
sp|A9ENT2|SATC1_SORC5 Probable bifunctional SAT/APS kinase 1 OS=Sorangium cellulosum (strain So ce56) GN=sat1/cysC1 PE=3 SV=1 396 570 9.0E-29
sp|A1S9N4|CYSC_SHEAM Adenylyl-sulfate kinase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysC PE=3 SV=1 388 554 9.0E-29
sp|A1RGG0|CYSC_SHESW Adenylyl-sulfate kinase OS=Shewanella sp. (strain W3-18-1) GN=cysC PE=3 SV=1 399 575 1.0E-28
sp|A4Y9X0|CYSC_SHEPC Adenylyl-sulfate kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysC PE=3 SV=1 399 575 1.0E-28
sp|A3D819|CYSC_SHEB5 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysC PE=3 SV=1 399 575 1.0E-28
sp|B9LKC1|CYSC_CHLSY Adenylyl-sulfate kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=cysC PE=3 SV=1 389 570 1.0E-28
sp|A9L392|CYSC_SHEB9 Adenylyl-sulfate kinase OS=Shewanella baltica (strain OS195) GN=cysC PE=3 SV=1 399 575 3.0E-28
sp|B9DLK2|CYSC_STACT Adenylyl-sulfate kinase OS=Staphylococcus carnosus (strain TM300) GN=cysC PE=3 SV=1 396 575 3.0E-28
sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2 27 390 4.0E-28
sp|Q9K7H6|CYSC2_BACHD Probable adenylyl-sulfate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3385 PE=3 SV=1 399 570 4.0E-28
sp|Q49UM5|CYSC_STAS1 Adenylyl-sulfate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysC PE=3 SV=1 381 575 5.0E-28
sp|B0JL16|CYSC_MICAN Adenylyl-sulfate kinase OS=Microcystis aeruginosa (strain NIES-843) GN=cysC PE=3 SV=1 394 565 5.0E-28
sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Cavia porcellus GN=PAPSS1 PE=2 SV=1 27 390 5.0E-28
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 378 575 6.0E-28
sp|Q9KCT0|CYSC1_BACHD Probable adenylyl-sulfate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH1489 PE=3 SV=1 385 572 8.0E-28
sp|Q9KP21|CYSC_VIBCH Adenylyl-sulfate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysC PE=3 SV=1 399 569 1.0E-27
sp|Q1I2K4|CYSC_PSEE4 Adenylyl-sulfate kinase OS=Pseudomonas entomophila (strain L48) GN=cysC PE=3 SV=1 399 575 2.0E-27
sp|Q54506|SAT_RIFPS Sulfate adenylyltransferase OS=Riftia pachyptila sulfur-oxidizing endosymbiont GN=sat PE=1 SV=1 10 294 2.0E-27
sp|Q4L9E6|CYSC_STAHJ Adenylyl-sulfate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysC PE=3 SV=1 396 575 2.0E-27
sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2 27 390 2.0E-27
sp|Q8AAQ1|CYSC_BACTN Adenylyl-sulfate kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysC PE=3 SV=1 395 566 3.0E-27
sp|Q8CR04|CYSC_STAES Adenylyl-sulfate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysC PE=3 SV=1 393 575 3.0E-27
sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=1 SV=1 27 390 4.0E-27
sp|B7K8N5|CYSC_CYAP7 Adenylyl-sulfate kinase OS=Cyanothece sp. (strain PCC 7424) GN=cysC PE=3 SV=1 394 566 5.0E-27
sp|A5G863|CYSC_GEOUR Adenylyl-sulfate kinase OS=Geobacter uraniireducens (strain Rf4) GN=cysC PE=3 SV=1 398 573 9.0E-27
sp|A6KXG9|CYSC_BACV8 Adenylyl-sulfate kinase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=cysC PE=3 SV=1 395 569 1.0E-26
sp|Q5HL02|CYSC_STAEQ Adenylyl-sulfate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysC PE=3 SV=1 393 575 1.0E-26
sp|Q8EQN3|CYSC_OCEIH Adenylyl-sulfate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysC PE=3 SV=1 383 575 1.0E-26
sp|P56861|CYSC_DEIRA Adenylyl-sulfate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cysC PE=3 SV=1 394 566 2.0E-26
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 365 573 2.0E-26
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 365 573 2.0E-26
sp|Q5LES5|CYSC_BACFN Adenylyl-sulfate kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysC PE=3 SV=1 395 566 2.0E-26
sp|A7Z4I0|CYSC_BACMF Adenylyl-sulfate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysC PE=3 SV=1 385 555 5.0E-26
sp|Q27128|PAPSS_URECA Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo PE=2 SV=1 396 575 6.0E-26
sp|Q87SX6|CYSC_VIBPA Adenylyl-sulfate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysC PE=3 SV=1 399 566 6.0E-26
sp|B9M543|CYSC_GEODF Adenylyl-sulfate kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysC PE=3 SV=1 396 575 1.0E-25
sp|Q64VR1|CYSC_BACFR Adenylyl-sulfate kinase OS=Bacteroides fragilis (strain YCH46) GN=cysC PE=3 SV=1 395 566 2.0E-25
sp|Q1IYI1|CYSC_DEIGD Adenylyl-sulfate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=cysC PE=3 SV=1 392 566 2.0E-25
sp|O34577|CYSC1_BACSU Probable adenylyl-sulfate kinase OS=Bacillus subtilis (strain 168) GN=cysC PE=2 SV=1 385 552 3.0E-25
sp|Q1D6P1|CYSC_MYXXD Adenylyl-sulfate kinase OS=Myxococcus xanthus (strain DK 1622) GN=cysC PE=3 SV=1 397 575 6.0E-25
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 376 565 7.0E-25
sp|O43252|PAPS1_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2 396 575 2.0E-24
sp|Q60967|PAPS1_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus GN=Papss1 PE=1 SV=1 396 575 2.0E-24
sp|O06735|CYSC2_BACSU Probable adenylyl-sulfate kinase OS=Bacillus subtilis (strain 168) GN=yisZ PE=3 SV=2 399 575 2.0E-24
sp|A8FD25|CYSC_BACP2 Adenylyl-sulfate kinase OS=Bacillus pumilus (strain SAFR-032) GN=cysC PE=3 SV=1 394 553 3.0E-24
sp|Q65JT8|CYSC_BACLD Adenylyl-sulfate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysC PE=3 SV=1 387 573 3.0E-24
sp|O28606|SAT_ARCFU Sulfate adenylyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sat PE=3 SV=2 5 316 5.0E-24
sp|Q8K9D4|CYSC_BUCAP Adenylyl-sulfate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysC PE=3 SV=1 381 563 6.0E-24
sp|O95340|PAPS2_HUMAN Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2 396 575 7.0E-24
sp|P57497|CYSC_BUCAI Adenylyl-sulfate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysC PE=3 SV=1 396 549 8.0E-24
sp|O54820|PAPS1_CAVPO Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Cavia porcellus GN=PAPSS1 PE=2 SV=1 396 575 9.0E-24
sp|Q8DJ87|CYSC_THEEB Adenylyl-sulfate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysC PE=3 SV=1 396 575 9.0E-24
sp|O88428|PAPS2_MOUSE Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus GN=Papss2 PE=1 SV=2 396 575 1.0E-23
sp|A4SRG6|CYSC_AERS4 Adenylyl-sulfate kinase OS=Aeromonas salmonicida (strain A449) GN=cysC PE=3 SV=1 398 569 1.0E-23
sp|P28604|NODQ_AZOBR Bifunctional enzyme NodQ OS=Azospirillum brasilense GN=nodQ PE=3 SV=2 399 574 1.0E-23
sp|Q84JF0|APK4_ARATH Adenylyl-sulfate kinase 4, chloroplastic OS=Arabidopsis thaliana GN=APK4 PE=1 SV=1 395 555 1.0E-23
sp|A9G7W0|SATC2_SORC5 Probable bifunctional SAT/APS kinase 2 OS=Sorangium cellulosum (strain So ce56) GN=sat2/cysC2 PE=3 SV=1 396 570 2.0E-23
sp|Q43295|APK1_ARATH Adenylyl-sulfate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=APK1 PE=1 SV=1 395 551 2.0E-23
sp|Q9SRW7|APK3_ARATH Adenylyl-sulfate kinase 3 OS=Arabidopsis thaliana GN=APK3 PE=1 SV=1 394 575 3.0E-23
sp|A0KP33|CYSC_AERHH Adenylyl-sulfate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysC PE=3 SV=1 398 575 3.0E-23
sp|Q9P7G9|KAPS_SCHPO Adenylyl-sulfate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met14 PE=3 SV=1 397 575 4.0E-23
sp|O49204|KAPS_CATRO Adenylyl-sulfate kinase, chloroplastic OS=Catharanthus roseus GN=AKN PE=2 SV=1 388 551 4.0E-23
sp|P56858|CYSC_PYRAB Probable adenylyl-sulfate kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysC PE=3 SV=1 396 555 7.0E-23
sp|C1CVW7|CYSC_DEIDV Adenylyl-sulfate kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=cysC PE=3 SV=1 397 566 9.0E-23
sp|Q92203|KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sD PE=3 SV=2 393 575 2.0E-22
sp|B5YJA6|CYSC_THEYD Adenylyl-sulfate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysC PE=3 SV=1 396 551 3.0E-22
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 399 551 6.0E-22
sp|O49196|APK2_ARATH Adenylyl-sulfate kinase 2, chloroplastic OS=Arabidopsis thaliana GN=APK2 PE=1 SV=1 394 551 6.0E-22
sp|Q9YCR6|CYSC_AERPE Probable adenylyl-sulfate kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysC PE=1 SV=2 395 571 7.0E-22
sp|Q7UQW3|CYSC_RHOBA Adenylyl-sulfate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysC PE=3 SV=2 395 549 8.0E-22
sp|B0CAX3|CYSC_ACAM1 Adenylyl-sulfate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=cysC PE=3 SV=1 399 575 3.0E-21
sp|Q02196|KAPS_YEAST Adenylyl-sulfate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET14 PE=1 SV=1 393 575 6.0E-21
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 393 549 7.0E-21
sp|Q9HGF8|KAPS_SACBA Adenylyl-sulfate kinase OS=Saccharomyces bayanus GN=MET14 PE=3 SV=1 393 561 2.0E-20
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 399 549 2.0E-20
sp|Q9C2Y6|KAPS_SACPS Adenylyl-sulfate kinase OS=Saccharomyces pastorianus GN=MET14 PE=3 SV=1 393 561 3.0E-20
sp|O29953|CYSC_ARCFU Probable adenylyl-sulfate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cysC PE=3 SV=1 398 555 3.0E-19
sp|Q12657|KAPS_PENCH Adenylyl-sulfate kinase OS=Penicillium chrysogenum PE=1 SV=1 393 575 4.0E-19
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 399 567 1.0E-18
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 399 569 2.0E-18
sp|Q0BI00|CYSC_BURCM Adenylyl-sulfate kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysC PE=3 SV=1 393 566 5.0E-17
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 385 574 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004781 sulfate adenylyltransferase (ATP) activity Yes
GO:0070566 adenylyltransferase activity No
GO:0003674 molecular_function No
GO:0004779 sulfate adenylyltransferase activity No
GO:0016740 transferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042870
MANSPHGGVLKDLIARDVRIANELEEETQSLPNIILTERQLCDLELIMNGGFSPLEGFMNEANYTSVVDNLRLVN
GTLFSMPITLDVSKADIESIGIMPGSRITLRDPRDDEALAIITVDDVYKPDQVREAIRVFGADDPAHPSVAYLRK
NVKEFYVGGKVQAIRAPIHFDYVALRYTPAELRAHFTKLAWRRVVAFQTRNPMHRAHRELTVRAARQHRANVLIH
PVVGLTKPGDVDHYTRVRVYEAIMQKYPNGMGHLALLPLAMRMAGPREAVWHAIIRKNFGATHFIVGRDHAGPGK
NSLGKDFYGPYDAQDLVMKYRDELQIEMVPFQQMTYLPSTDEYQPVDEVPKGVQTLDISGTELRRRLRTGAPIPD
WFSYDAVVKVLRESYPPRHKQGFVLFFTGLHNSGKDQIAKALQVSLYEQGGRSVSLLLGETVRQELSAELGYSRE
DRHKNLQRIAFVAAELTRAGAAVIAAPIAPHEASREAARETILQNGGAGANVFLIHVATPLEYCERTDRKGLFAK
ARRGEIVGFSGVDDLYEVPSKADITVDVSRQGVPEIVHSILLLLEAQSLL*
Coding >AgabiH97|042870
ATGGCCAATTCTCCTCATGGTGGCGTCCTCAAGGACCTAATTGCTCGTGACGTTCGCATTGCTAATGAGCTGGAA
GAAGAAACCCAGTCGCTTCCGAATATCATTCTCACTGAACGTCAACTATGTGATCTTGAACTGATCATGAACGGT
GGCTTTAGCCCTCTGGAGGGTTTCATGAACGAGGCTAACTACACCAGTGTCGTGGATAATTTGCGCCTCGTCAAT
GGAACGCTTTTTTCCATGCCAATTACCCTCGACGTCTCGAAAGCAGACATCGAGAGCATAGGTATCATGCCTGGA
TCTCGAATAACATTGCGAGACCCGCGTGATGACGAGGCCCTGGCTATAATTACCGTGGACGATGTCTACAAACCT
GACCAGGTCAGAGAGGCCATCCGGGTCTTCGGTGCGGATGACCCCGCACATCCATCCGTAGCCTACCTTCGTAAG
AACGTGAAGGAGTTCTATGTTGGGGGTAAGGTGCAAGCCATCCGTGCACCTATACATTTTGATTACGTCGCTCTC
CGATATACGCCTGCTGAGCTTCGTGCTCATTTTACAAAACTTGCGTGGCGCCGTGTTGTTGCCTTCCAGACCAGA
AACCCTATGCACCGTGCTCACCGCGAACTAACGGTTCGCGCTGCTCGCCAACACCGAGCTAATGTTCTCATCCAT
CCCGTCGTTGGACTCACCAAGCCCGGCGATGTGGATCATTATACCCGTGTTCGTGTATACGAAGCTATTATGCAA
AAGTACCCTAACGGAATGGGACACCTCGCTCTTCTTCCCCTGGCCATGCGGATGGCCGGTCCTCGCGAGGCCGTT
TGGCATGCTATTATCCGCAAAAACTTCGGAGCAACACATTTCATTGTGGGCAGAGACCACGCAGGTCCCGGAAAA
AATTCTCTTGGAAAGGATTTCTATGGTCCTTATGATGCCCAGGATTTGGTTATGAAGTACCGAGATGAATTACAA
ATCGAAATGGTTCCCTTCCAGCAAATGACATATCTACCTTCAACGGACGAATACCAACCTGTTGATGAGGTTCCC
AAGGGCGTTCAAACCCTTGATATTTCTGGGACTGAACTTCGAAGACGATTGCGTACAGGTGCTCCTATCCCTGAT
TGGTTCAGTTACGACGCTGTTGTGAAAGTTCTCCGTGAAAGCTATCCTCCTAGACACAAGCAAGGCTTTGTACTT
TTCTTCACCGGCCTTCATAACTCGGGAAAGGACCAAATTGCCAAAGCATTGCAGGTATCTCTCTATGAACAAGGT
GGACGCAGCGTTTCGCTTCTCCTAGGAGAGACCGTTCGTCAAGAACTTTCAGCAGAACTTGGTTACTCTCGCGAA
GACCGCCACAAAAACCTGCAACGCATCGCTTTCGTTGCTGCAGAGTTAACGAGAGCTGGTGCAGCTGTTATTGCT
GCTCCCATTGCCCCACACGAAGCTTCTCGTGAGGCGGCTCGTGAAACCATCCTACAAAATGGTGGCGCCGGCGCT
AACGTGTTCCTCATCCATGTTGCGACCCCTCTAGAGTACTGCGAGAGGACGGACAGAAAGGGTCTCTTTGCCAAG
GCTCGTCGTGGTGAGATTGTTGGCTTCAGCGGCGTTGATGATTTGTATGAGGTGCCCAGCAAAGCCGATATTACT
GTAGATGTGTCCAGGCAAGGCGTCCCTGAAATTGTTCACAGCATACTTTTGCTTCTAGAAGCACAGTCACTACTT
TAG
Transcript >AgabiH97|042870
ATGGCCAATTCTCCTCATGGTGGCGTCCTCAAGGACCTAATTGCTCGTGACGTTCGCATTGCTAATGAGCTGGAA
GAAGAAACCCAGTCGCTTCCGAATATCATTCTCACTGAACGTCAACTATGTGATCTTGAACTGATCATGAACGGT
GGCTTTAGCCCTCTGGAGGGTTTCATGAACGAGGCTAACTACACCAGTGTCGTGGATAATTTGCGCCTCGTCAAT
GGAACGCTTTTTTCCATGCCAATTACCCTCGACGTCTCGAAAGCAGACATCGAGAGCATAGGTATCATGCCTGGA
TCTCGAATAACATTGCGAGACCCGCGTGATGACGAGGCCCTGGCTATAATTACCGTGGACGATGTCTACAAACCT
GACCAGGTCAGAGAGGCCATCCGGGTCTTCGGTGCGGATGACCCCGCACATCCATCCGTAGCCTACCTTCGTAAG
AACGTGAAGGAGTTCTATGTTGGGGGTAAGGTGCAAGCCATCCGTGCACCTATACATTTTGATTACGTCGCTCTC
CGATATACGCCTGCTGAGCTTCGTGCTCATTTTACAAAACTTGCGTGGCGCCGTGTTGTTGCCTTCCAGACCAGA
AACCCTATGCACCGTGCTCACCGCGAACTAACGGTTCGCGCTGCTCGCCAACACCGAGCTAATGTTCTCATCCAT
CCCGTCGTTGGACTCACCAAGCCCGGCGATGTGGATCATTATACCCGTGTTCGTGTATACGAAGCTATTATGCAA
AAGTACCCTAACGGAATGGGACACCTCGCTCTTCTTCCCCTGGCCATGCGGATGGCCGGTCCTCGCGAGGCCGTT
TGGCATGCTATTATCCGCAAAAACTTCGGAGCAACACATTTCATTGTGGGCAGAGACCACGCAGGTCCCGGAAAA
AATTCTCTTGGAAAGGATTTCTATGGTCCTTATGATGCCCAGGATTTGGTTATGAAGTACCGAGATGAATTACAA
ATCGAAATGGTTCCCTTCCAGCAAATGACATATCTACCTTCAACGGACGAATACCAACCTGTTGATGAGGTTCCC
AAGGGCGTTCAAACCCTTGATATTTCTGGGACTGAACTTCGAAGACGATTGCGTACAGGTGCTCCTATCCCTGAT
TGGTTCAGTTACGACGCTGTTGTGAAAGTTCTCCGTGAAAGCTATCCTCCTAGACACAAGCAAGGCTTTGTACTT
TTCTTCACCGGCCTTCATAACTCGGGAAAGGACCAAATTGCCAAAGCATTGCAGGTATCTCTCTATGAACAAGGT
GGACGCAGCGTTTCGCTTCTCCTAGGAGAGACCGTTCGTCAAGAACTTTCAGCAGAACTTGGTTACTCTCGCGAA
GACCGCCACAAAAACCTGCAACGCATCGCTTTCGTTGCTGCAGAGTTAACGAGAGCTGGTGCAGCTGTTATTGCT
GCTCCCATTGCCCCACACGAAGCTTCTCGTGAGGCGGCTCGTGAAACCATCCTACAAAATGGTGGCGCCGGCGCT
AACGTGTTCCTCATCCATGTTGCGACCCCTCTAGAGTACTGCGAGAGGACGGACAGAAAGGGTCTCTTTGCCAAG
GCTCGTCGTGGTGAGATTGTTGGCTTCAGCGGCGTTGATGATTTGTATGAGGTGCCCAGCAAAGCCGATATTACT
GTAGATGTGTCCAGGCAAGGCGTCCCTGAAATTGTTCACAGCATACTTTTGCTTCTAGAAGCACAGTCACTACTT
TAG
Gene >AgabiH97|042870
ATGGCCAATTCTCCTCATGGTGGCGTCCTCAAGGTTTTTGCATTTTTTCCTTTAGGAGGCGTGTAGTCTAACTCG
CTCCAGGACCTAATTGCTCGTGACGTTCGCATTGCTAATGAGCTGGAAGAAGAAACCCAGTCGCTTCCGAATATC
ATTCTCACTGAAGTCAGTAACGAATTGGATCATGACAGCAACTAATTAATGGATGTCATTTCTTCAGCGTCAACT
ATGTGATCTTGAACTGATCATGAACGGTGGCTTTAGCCCTCTGGAGGGTTTCATGAACGAGGCTAACTACACCAG
GTATGTCCGTTAGGTGGCACGAACACTTGCTTGCTGACTTCTCATCAGTGTCGTGGATAATTTGCGCCTCGTCAA
TGGAACGCTTTTTTCCATGCCAATTACCCTCGACGTCTCGAAAGCAGACATCGAGAGCATAGGTATCATGCCTGG
ATCTCGAATAACATTGCGAGACCCGCGTGATGACGAGGCCCTGGCTATAATTACCGGTATGTATGTTACATCTAG
ACTTAGATGAAAAGCCACTCAAGTCCGTTAGTGGACGATGTCTACAAACCTGACCAGGTCAGAGAGGCCATCCGG
GTCTTCGGTGCGGATGACCCCGCACATCCATCCGTAGCCTACCTTCGTAAGAACGTGAAGGAGTTCTATGTTGGG
GGTAAGGTGCAAGCCATCCGTGCACCTATACATTTTGATTACGTCGCTCTCCGATGTAGGCTATATGACTTTAAA
GCTCTTTCTATATCTTTGTGCTAATGGTATCGTTAGATACGCCTGCTGAGCTTCGTGCTCATTTTACAAAACTTG
CGTGGCGCCGTGTTGTTGCCTTCCAGACCAGAAACCCTATGCACCGTGCTCACCGCGAACTAACGGTTCGCGCTG
CTCGCCAACACCGAGCTGTAAGAAATCCATCTATGTCCATAAAAAAACTCCCCTCACGAGAGTCATAGAATGTTC
TCATCCATCCCGTCGTTGGACTCACCAAGCCCGGCGATGTGGATCATTATACCCGTGTTCGTGTATACGAAGCTA
TTATGCAAAAGTACCCTAACGGAATGGGACACCTCGCTCTTCTTCCCCTGGCCATGCGGATGGCCGGTCCTCGCG
AGGCCGTTTGGCATGCTATTATCCGCAAAAACTTCGGAGCAACACATTTCATTGTGGGCAGAGACCACGCAGGTC
CCGGAAAAAATTCTCTTGGAAAGGATTTCTATGGTCCTTATGATGCCCAGGATTTGGTTATGAAGTACCGAGATG
AATTACAAATCGAAATGGTTCCCTTCCAGCAAATGACATATCTACCTTCAACGGACGAATACCAACCTGTTGATG
AGGTTCCCAAGGGCGTTCAAACCCTTGATATTTCTGGGACTGAACTTCGAAGACGATTGCGTACAGGTGCTCCTA
TCCCTGATTGGTTCAGTTACGAGTGAGCGTCAACTGCTACTCAGTGTGTTCCTCGAAACTGATCCGCCTTCCAGC
GCTGTTGTGAAAGTTCTCCGTGAAAGCTATCCTCCTAGACACAAGCAAGGCTTTGTACTTTTCTTCACCGGCCTT
CATAACTCGGGAAAGGACCAAATTGCCAAAGCATTGCAGGTATCTCTCTATGAACAAGGTGGACGCAGCGTTTCG
CTTCTCCTAGGAGAGACCGTTCGTCAAGAACTTTCAGCAGGCAGGTGTCTATCACTTCAAACACATAGCAGGGTC
TCATCTATGTTGCAGAACTTGGTTACTCTCGCGAAGACCGCCACAAAAACCTGCAACGCATCGCTTTCGTTGCTG
CAGAGTTAACGAGAGCTGGTGCAGCTGTTATTGCTGCTCCCATTGCCCCACACGAAGCTTCTCGTGAGGCGGCTC
GTGAAACCATCCTACAAAATGGTGGCGCCGGCGCTAACGTGTTCCTCATCCATGTTGCGACCCCTCTAGAGTACT
GCGAGAGGACGGACAGAAAGGGTCTCTTTGCCAAGGCTCGTCGTGGTGAGATTGTTGGCTTCAGCGGCGTTGATG
ATTTGTATGAGGTGCCCAGCAAAGCCGATATTACTGTAGATGTGTCCAGGCAAGGCGTCCCTGAAATTGTTCACA
GCATACTTTTGCTTCTAGAAGCACAGTCACTACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail