Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042630
Gene name
Locationscaffold_2:1041568..1044034
Strand+
Gene length (bp)2466
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain 3.5E-17 12 92
PF03909 BSD BSD domain 1.1E-12 245 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13745|TFB1_SCHPO RNA polymerase II transcription factor B subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb1 PE=1 SV=2 13 609 1.0E-37
sp|Q55FP1|TF2H1_DICDI General transcription factor IIH subunit 1 OS=Dictyostelium discoideum GN=gtf2h1 PE=3 SV=1 17 382 2.0E-31
sp|P32776|TFB1_YEAST RNA polymerase II transcription factor B subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB1 PE=1 SV=1 71 595 7.0E-27
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 2 462 2.0E-25
sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 178 534 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13745|TFB1_SCHPO RNA polymerase II transcription factor B subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb1 PE=1 SV=2 13 609 1.0E-37
sp|Q55FP1|TF2H1_DICDI General transcription factor IIH subunit 1 OS=Dictyostelium discoideum GN=gtf2h1 PE=3 SV=1 17 382 2.0E-31
sp|P32776|TFB1_YEAST RNA polymerase II transcription factor B subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB1 PE=1 SV=1 71 595 7.0E-27
sp|Q9P5N7|TFB1_NEUCR Putative RNA polymerase II transcription factor B subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8B20.390 PE=3 SV=1 2 462 2.0E-25
sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 178 534 6.0E-23
sp|Q9DBA9|TF2H1_MOUSE General transcription factor IIH subunit 1 OS=Mus musculus GN=Gtf2h1 PE=1 SV=2 178 534 1.0E-22
sp|Q960E8|TF2H1_DROME General transcription factor IIH subunit 1 OS=Drosophila melanogaster GN=Tfb1 PE=2 SV=1 174 574 3.0E-19
sp|Q9M322|TFB1C_ARATH Probable RNA polymerase II transcription factor B subunit 1-3 OS=Arabidopsis thaliana GN=TFB1-3 PE=2 SV=2 174 601 1.0E-14
sp|Q3ECP0|TFB1A_ARATH Probable RNA polymerase II transcription factor B subunit 1-1 OS=Arabidopsis thaliana GN=TFB1-1 PE=2 SV=1 172 380 1.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042630
MPTIVCTAKVSCKKLPGLLELTDSHLQWTQEGHKAPSILLPRADLSSLFCSKEGAPQVRLKIALFTDENGHNFTF
VSPSARNERDKFKKELTQIVGTNKAIADAGARKPLIPAPTPIAAVSSTPTKLSTPTVSNASTPKPSGGVPIIPAS
RAASVASERRASTPVIVGVDPVNDFKLRRKVLMGDPDLAALHKDLVIGGQITEAEFWDGREHLLLAQSATDSQRK
GKPGQLVDPRPETVDGGEIKIRITPQLVYDIFDEYPVVAKAYSENVPSQLTEEQFWKRYFQSKLFNVHRASIRSS
ATQHVVKDDDVFDKYLERDDDEMEPRRQRADPVEALIDLAATLEDHGETGNEKDITMQAGRQRGALPLIRKFNEH
SERLLNSALGEVPPAKRRRLDPGEDRYAPIELDDLNDSEASAGILLEMKDRQRYFEGRTAGQAEDAEAKNSEDYD
AILHELQTNLQSWGVNLTQLKIERKAGDSALIGMTHNVAALLDVRSRKNDIPDGFFRQLTTCQTAANEFLRQFWS
ATYPLPVDSQSILSIATPAQRAAKAAKMIGYLAKTSEKVDSLVRLAQQHGVDGSRVETAMRPLLNAVNHALKFHQ
NKKLQPPPARR*
Coding >AgabiH97|042630
ATGCCTACCATAGTGTGTACGGCAAAAGTATCCTGCAAAAAACTCCCTGGCTTGCTTGAGCTCACAGACAGCCAC
CTACAATGGACTCAGGAAGGGCATAAGGCCCCTTCAATACTCCTCCCTCGGGCTGATTTGTCTTCGTTGTTCTGC
AGCAAAGAGGGCGCACCGCAAGTCAGGCTTAAAATTGCGCTCTTCACGGACGAAAATGGCCACAATTTCACGTTC
GTCTCGCCCAGTGCTCGGAATGAACGCGACAAGTTCAAAAAAGAGTTGACGCAAATCGTTGGAACTAACAAGGCC
ATTGCTGATGCTGGAGCTCGAAAACCCCTAATACCTGCACCTACGCCTATTGCTGCTGTATCCTCTACGCCCACT
AAGCTCTCTACGCCGACCGTTTCGAATGCTTCAACACCTAAACCCTCTGGTGGCGTTCCTATTATTCCTGCATCT
CGCGCCGCGTCTGTCGCGAGTGAACGACGAGCATCTACCCCAGTCATCGTCGGTGTTGACCCCGTCAACGATTTC
AAGCTTCGGAGAAAAGTCCTAATGGGCGATCCTGACCTCGCAGCGCTTCACAAGGATCTTGTCATCGGTGGTCAA
ATCACGGAAGCAGAGTTCTGGGACGGAAGAGAGCACTTGTTGCTCGCTCAATCCGCGACGGACAGCCAACGGAAG
GGTAAGCCAGGTCAATTAGTCGACCCGCGACCAGAGACAGTCGACGGCGGAGAAATCAAGATTCGTATTACCCCG
CAGCTCGTTTATGACATCTTTGACGAGTACCCCGTGGTGGCTAAAGCATATAGCGAGAATGTCCCCAGTCAACTT
ACCGAAGAGCAATTTTGGAAACGATATTTCCAGTCCAAATTATTCAACGTACATCGTGCATCTATTCGGTCCTCG
GCAACTCAACATGTTGTCAAAGACGATGACGTCTTCGATAAATATCTAGAGAGAGATGATGATGAGATGGAACCT
CGACGGCAGAGAGCAGATCCTGTTGAAGCGCTAATTGACTTGGCCGCTACTCTGGAGGATCATGGAGAGACTGGC
AATGAGAAAGATATTACCATGCAAGCCGGGCGACAAAGGGGCGCACTTCCTCTGATACGCAAGTTTAATGAGCAT
TCAGAACGGCTTCTAAATTCTGCTTTGGGTGAAGTACCTCCCGCCAAACGACGGCGGCTTGATCCAGGAGAGGAT
CGTTATGCGCCGATTGAATTGGATGATCTTAATGATTCAGAGGCATCCGCTGGCATTCTGCTAGAAATGAAAGAC
CGGCAACGTTATTTTGAAGGTCGGACGGCTGGCCAAGCAGAGGATGCAGAGGCTAAAAATAGCGAGGATTACGAT
GCCATTCTACATGAACTACAAACCAATCTCCAAAGCTGGGGTGTCAACTTAACACAACTTAAGATCGAACGTAAA
GCTGGAGACAGTGCGTTGATAGGAATGACGCACAATGTTGCGGCACTACTCGATGTCAGGTCACGAAAAAACGAT
ATTCCCGATGGCTTCTTCAGACAGTTGACAACATGTCAAACGGCAGCCAATGAGTTCCTCCGACAATTTTGGTCG
GCGACATATCCTCTGCCCGTGGATTCACAATCAATTCTTTCAATTGCTACTCCTGCGCAACGAGCTGCCAAGGCG
GCTAAAATGATCGGTTACCTCGCGAAAACCTCTGAAAAAGTTGACTCTTTGGTGCGTTTAGCCCAACAACATGGC
GTCGATGGATCTCGGGTTGAAACAGCCATGAGACCTCTGCTCAACGCAGTAAATCATGCTTTAAAATTCCACCAG
AATAAGAAGCTCCAGCCTCCCCCGGCCCGAAGATAA
Transcript >AgabiH97|042630
ATGCCTACCATAGTGTGTACGGCAAAAGTATCCTGCAAAAAACTCCCTGGCTTGCTTGAGCTCACAGACAGCCAC
CTACAATGGACTCAGGAAGGGCATAAGGCCCCTTCAATACTCCTCCCTCGGGCTGATTTGTCTTCGTTGTTCTGC
AGCAAAGAGGGCGCACCGCAAGTCAGGCTTAAAATTGCGCTCTTCACGGACGAAAATGGCCACAATTTCACGTTC
GTCTCGCCCAGTGCTCGGAATGAACGCGACAAGTTCAAAAAAGAGTTGACGCAAATCGTTGGAACTAACAAGGCC
ATTGCTGATGCTGGAGCTCGAAAACCCCTAATACCTGCACCTACGCCTATTGCTGCTGTATCCTCTACGCCCACT
AAGCTCTCTACGCCGACCGTTTCGAATGCTTCAACACCTAAACCCTCTGGTGGCGTTCCTATTATTCCTGCATCT
CGCGCCGCGTCTGTCGCGAGTGAACGACGAGCATCTACCCCAGTCATCGTCGGTGTTGACCCCGTCAACGATTTC
AAGCTTCGGAGAAAAGTCCTAATGGGCGATCCTGACCTCGCAGCGCTTCACAAGGATCTTGTCATCGGTGGTCAA
ATCACGGAAGCAGAGTTCTGGGACGGAAGAGAGCACTTGTTGCTCGCTCAATCCGCGACGGACAGCCAACGGAAG
GGTAAGCCAGGTCAATTAGTCGACCCGCGACCAGAGACAGTCGACGGCGGAGAAATCAAGATTCGTATTACCCCG
CAGCTCGTTTATGACATCTTTGACGAGTACCCCGTGGTGGCTAAAGCATATAGCGAGAATGTCCCCAGTCAACTT
ACCGAAGAGCAATTTTGGAAACGATATTTCCAGTCCAAATTATTCAACGTACATCGTGCATCTATTCGGTCCTCG
GCAACTCAACATGTTGTCAAAGACGATGACGTCTTCGATAAATATCTAGAGAGAGATGATGATGAGATGGAACCT
CGACGGCAGAGAGCAGATCCTGTTGAAGCGCTAATTGACTTGGCCGCTACTCTGGAGGATCATGGAGAGACTGGC
AATGAGAAAGATATTACCATGCAAGCCGGGCGACAAAGGGGCGCACTTCCTCTGATACGCAAGTTTAATGAGCAT
TCAGAACGGCTTCTAAATTCTGCTTTGGGTGAAGTACCTCCCGCCAAACGACGGCGGCTTGATCCAGGAGAGGAT
CGTTATGCGCCGATTGAATTGGATGATCTTAATGATTCAGAGGCATCCGCTGGCATTCTGCTAGAAATGAAAGAC
CGGCAACGTTATTTTGAAGGTCGGACGGCTGGCCAAGCAGAGGATGCAGAGGCTAAAAATAGCGAGGATTACGAT
GCCATTCTACATGAACTACAAACCAATCTCCAAAGCTGGGGTGTCAACTTAACACAACTTAAGATCGAACGTAAA
GCTGGAGACAGTGCGTTGATAGGAATGACGCACAATGTTGCGGCACTACTCGATGTCAGGTCACGAAAAAACGAT
ATTCCCGATGGCTTCTTCAGACAGTTGACAACATGTCAAACGGCAGCCAATGAGTTCCTCCGACAATTTTGGTCG
GCGACATATCCTCTGCCCGTGGATTCACAATCAATTCTTTCAATTGCTACTCCTGCGCAACGAGCTGCCAAGGCG
GCTAAAATGATCGGTTACCTCGCGAAAACCTCTGAAAAAGTTGACTCTTTGGTGCGTTTAGCCCAACAACATGGC
GTCGATGGATCTCGGGTTGAAACAGCCATGAGACCTCTGCTCAACGCAGTAAATCATGCTTTAAAATTCCACCAG
AATAAGAAGCTCCAGCCTCCCCCGGCCCGAAGATAA
Gene >AgabiH97|042630
ATGCCTACCATAGTGTGTACGGCAAAAGTATCCTGCAAAAAACTCCCTGGCTTGCTTGAGCTCACAGACAGCCAC
CTACAATGGACTCAGGAAGGGCATAAGGCCCCTTCAATACTCCTCCCTCGGGCTGATTTGTCTTGTGAGTTGTAG
ACCGATCGCGTCTTATAATTGCTTTATAACTGTGAACTAGCGTTGTTCTGCAGCAAAGAGGGCGCACCGCAAGTC
AGGCTTAAAATTGCGCTCTTCACGGACGAAAATGGCCACAATTTCACGTTCGTCTCGCCCAGTGCTCGGAATGAA
CGCGACAAGTTCAAAAAAGAGTTGACGCAAATCGTTGGAACTAACAAGGCCATTGCTGATGCTGGAGCTCGAAAA
CCCCTAATACCTGCACCTACGCCTATTGCTGCTGTATCCTCTACGCCCACTAAGCTCTCTACGCCGACCGTTTCG
AATGCTTCAACACCTAAACCCTCTGGTGGCGTTCCTATTATTCCTGCATCTCGCGCCGCGTCTGTCGCGAGTGAA
CGACGAGCATCTACCCCAGTCATCGTCGGTGTTGACCCCGTCAACGATTTCAAGCTTCGGAGAAAAGTCCTAATG
GGCGATCCTGACCTCGCAGCGCTTCACAAGGATCTTGTCATCGGTGGTCAAATCACGGAAGCAGAGTTCTGGGAC
GGAAGAGAGGTATTTTTCATCCATTCTTATCTATTCAGTAGTTACATATGCAATAATAGCACTTGTTGCTCGCTC
AATCCGCGACGGACAGCCAACGGAAGGGTAAGCCAGGTCAATTAGTCGACCCGCGACCAGAGACAGTCGACGGCG
GAGAAATCAAGATTCGTATTACCCCGCAGCTCGTTTATGACATCTTTGACGAGTACCCCGTGGTGGCTAAAGCAT
ATAGCGAGAATGTCCCCAGTCAAGTAACATCAATTTGCTGAAATAAATTTGGTGATGGTTTCGCTGACTATCTTG
GATAGCTTACCGAAGAGCAATTTTGGAAACGATATTTCCAGTCCAAATTATTCAACGTACATCGTGCATCTATTC
GGTCCTCGGCAACTCAACATGTTGTCAAAGACGATGACGTCTTCGATAAATATCTAGAGAGAGATGATGATGGTA
CTGTTCATGGCTTGAAATAGGACATTTATTGATACACATTTTACCAGAGATGGAACCTCGACGGCAGAGAGCAGA
TCCTGTTGAAGCGCTAATTGACTTGGCCGCTACTCTGGAGGATCATGGAGAGGTATGGCTTGGACCTTCTTAGTT
CTTACAAGCCTTCCAACTTCCAATCTATAGACTGGCAATGAGAAAGATATTACCATGCAAGCCGGGCGACAAAGG
GGCGCACTTCCTCTGATACGCAAGTTTAATGAGCATTCAGAACGGCTTCTAAATTCTGCTTTGTACGTGGATGCA
CTTTTTCCTGAACGGTCTTATATATGCTTAAGTACAGGGGTGAAGTACCTCCCGCCAAACGACGGCGGCTTGATC
CAGGAGAGGTGAATTTATGCAGTCAAACTATGATGTGGCTTGGCAAACACATTTTTTTAGGATCGTTATGCGCCG
ATTGAATTGGATGATCTTAATGATTCAGAGGCATCCGCTGGCATTCTGCTAGAAATGAAAGACCGGCAACGTTAT
TTTGAAGGTCGGACGGCTGGCCAAGCAGAGGATGCAGAGGCTAAAAATGCGGGTCTTCGTTGATGCTTCTTTCTC
TTGCGCGCACTGATACAATGTTATCAGAGCGAGGATTACGATGCCATTCTACATGAACTACAAACCAATCTCCAA
AGCTGGGGTGTCAACTTAACACAAGTAAGCTTTCCGGCATACTTATGTGTCTTTACTTGGCTCATGGGATCATCT
CTCGACATTAGCTTAAGATCGAACGTAAAGCTGGAGACAGTGCGTTGATAGGAATGACGCACAATGTTGCGGCAC
TACTCGATGTCAGGTCACGAAAAAGTGAGCATATGGAAAACCATTAGATTTGGCGATGTCAAAAACCGTTGCCAC
CGCATTCATCATGCCGATTCACTGACCCTGTTCTATCCAGACGATATTCCCGATGGCTTCTTCAGACAGTTGACA
ACATGTCAAACGGCAGCCAATGAGTTCCTCCGACAATTTTGGTCGGCGACATATCCTCTGCCCGTGGATTCACAA
TCAATTCTTTCAATTGCTACTCCTGCGCAACGAGCTGCCAAGGCGGCTAAAATGATCGGTTACCTCGCGAAAACC
TCTGAAAAAGTTGACTCTTTGGTGCGTTTAGCCCAACAACATGGCGTCGATGGATCTCGGGTTGAAACAGTAAGG
CCATTTATCCGTATTCCATCAGCTTGTTTACGTTTACTTATGATGTCTACCAAGGCCATGAGACCTCTGCTCAAC
GCAGTAAATCATGCTTTAAAATTCCACCAGAATAAGAAGCTCCAGCCTCCCCCGGCCCGAAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail