Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042610
Gene name
Locationscaffold_2:1035366..1039756
Strand+
Gene length (bp)4390
Transcript length (bp)3870
Coding sequence length (bp)3870
Protein length (aa) 1290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.0E-51 428 764
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.0E-22 429 640
PF16093 PAC4 Proteasome assembly chaperone 4 5.9E-14 5 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P3|PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk15 PE=1 SV=1 348 771 4.0E-177
sp|P14680|YAK1_YEAST Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAK1 PE=1 SV=1 335 775 4.0E-175
sp|Q9Z188|DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus GN=Dyrk1b PE=1 SV=3 358 676 2.0E-82
sp|Q9Y463|DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens GN=DYRK1B PE=1 SV=1 358 676 2.0E-82
sp|P49657|MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster GN=mnb PE=2 SV=2 359 764 4.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P3|PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk15 PE=1 SV=1 348 771 4.0E-177
sp|P14680|YAK1_YEAST Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAK1 PE=1 SV=1 335 775 4.0E-175
sp|Q9Z188|DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus GN=Dyrk1b PE=1 SV=3 358 676 2.0E-82
sp|Q9Y463|DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens GN=DYRK1B PE=1 SV=1 358 676 2.0E-82
sp|P49657|MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster GN=mnb PE=2 SV=2 359 764 4.0E-82
sp|Q5U4C9|DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus GN=Dyrk2 PE=2 SV=1 398 792 2.0E-80
sp|Q92630|DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens GN=DYRK2 PE=1 SV=3 398 792 4.0E-80
sp|Q9NR20|DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens GN=DYRK4 PE=1 SV=2 387 772 7.0E-80
sp|Q8WQL7|MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans GN=mbk-1 PE=1 SV=1 398 764 7.0E-80
sp|Q76NV1|DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum GN=dyrk1 PE=3 SV=1 398 768 1.0E-79
sp|A8WJR8|MBK2_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae GN=mbk-2 PE=3 SV=2 397 764 3.0E-79
sp|Q8MQ70|HIPK_CAEEL Homeodomain-interacting protein kinase 1 OS=Caenorhabditis elegans GN=hpk-1 PE=2 SV=1 342 765 5.0E-79
sp|A8X4H1|MBK1_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis briggsae GN=mbk-1 PE=3 SV=2 398 664 6.0E-79
sp|Q9XTF3|MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans GN=mbk-2 PE=1 SV=1 397 764 8.0E-79
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 393 764 1.0E-78
sp|Q5ZIU3|DYRK2_CHICK Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus GN=DYRK2 PE=2 SV=1 398 785 1.0E-78
sp|Q8BI55|DYRK4_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus GN=Dyrk4 PE=2 SV=1 401 764 2.0E-78
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 398 765 2.0E-77
sp|O88850|HIPK3_RAT Homeodomain-interacting protein kinase 3 OS=Rattus norvegicus GN=Hipk3 PE=1 SV=1 385 765 3.0E-77
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 399 768 4.0E-77
sp|Q4V8A3|DYRK3_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus GN=Dyrk3 PE=2 SV=1 398 765 4.0E-77
sp|Q9ERH7|HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus GN=Hipk3 PE=1 SV=3 385 764 4.0E-77
sp|Q9WUM7|HIPK2_MESAU Homeodomain-interacting protein kinase 2 OS=Mesocricetus auratus GN=Hipk2 PE=1 SV=2 360 765 3.0E-76
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 398 765 4.0E-76
sp|Q9QZR5|HIPK2_MOUSE Homeodomain-interacting protein kinase 2 OS=Mus musculus GN=Hipk2 PE=1 SV=2 360 765 5.0E-76
sp|Q9H2X6|HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens GN=HIPK2 PE=1 SV=2 360 765 1.0E-75
sp|Q9H422|HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens GN=HIPK3 PE=1 SV=1 385 764 1.0E-75
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 398 765 2.0E-75
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 376 661 1.0E-74
sp|Q2TAE3|DYR1A_XENLA Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus laevis GN=dyrk1a PE=2 SV=1 358 676 1.0E-74
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 331 779 2.0E-73
sp|Q86Z02|HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens GN=HIPK1 PE=1 SV=1 408 765 9.0E-73
sp|A4L9P5|HIPK1_RAT Homeodomain-interacting protein kinase 1 OS=Rattus norvegicus GN=Hipk1 PE=2 SV=1 408 765 9.0E-73
sp|O88904|HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus GN=Hipk1 PE=1 SV=2 408 765 1.0E-72
sp|P83102|DYRK3_DROME Putative dual specificity tyrosine-phosphorylation-regulated kinase 3 homolog OS=Drosophila melanogaster GN=Dyrk3 PE=1 SV=3 398 650 3.0E-69
sp|Q8SQZ4|YAK1_ENCCU Probable dual specificity protein kinase YAK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=YAK1 PE=3 SV=1 387 661 7.0E-69
sp|Q4V793|HIPK4_RAT Homeodomain-interacting protein kinase 4 OS=Rattus norvegicus GN=Hipk4 PE=2 SV=1 421 765 1.0E-54
sp|Q8WP28|HIPK4_MACFA Homeodomain-interacting protein kinase 4 OS=Macaca fascicularis GN=HIPK4 PE=2 SV=1 421 769 7.0E-54
sp|Q3V016|HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus GN=Hipk4 PE=1 SV=2 421 765 1.0E-53
sp|Q8NE63|HIPK4_HUMAN Homeodomain-interacting protein kinase 4 OS=Homo sapiens GN=HIPK4 PE=1 SV=1 421 769 6.0E-53
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 403 765 2.0E-46
sp|Q54WE5|PRP4B_DICDI Serine/threonine-protein kinase prpf4B OS=Dictyostelium discoideum GN=prpf4B PE=3 SV=1 400 773 4.0E-46
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 376 765 2.0E-45
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 403 763 2.0E-45
sp|Q08DZ2|PRP4B_BOVIN Serine/threonine-protein kinase PRP4 homolog OS=Bos taurus GN=PRPF4B PE=2 SV=1 417 764 3.0E-45
sp|P22518|CLK1_MOUSE Dual specificity protein kinase CLK1 OS=Mus musculus GN=Clk1 PE=1 SV=2 420 671 7.0E-45
sp|Q61136|PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus GN=Prpf4b PE=1 SV=3 417 764 8.0E-45
sp|Q5RKH1|PRP4B_RAT Serine/threonine-protein kinase PRP4 homolog OS=Rattus norvegicus GN=Prpf4b PE=1 SV=1 417 764 9.0E-45
sp|Q13523|PRP4B_HUMAN Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens GN=PRPF4B PE=1 SV=3 417 764 1.0E-44
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 388 763 1.0E-44
sp|Q5R814|PRP4B_PONAB Serine/threonine-protein kinase PRP4 homolog OS=Pongo abelii GN=PRPF4B PE=2 SV=1 417 764 2.0E-44
sp|P49761|CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3 403 766 1.0E-43
sp|P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2 420 764 2.0E-43
sp|O35492|CLK3_MOUSE Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2 403 766 2.0E-43
sp|Q07538|PRP4_SCHPO Serine/threonine-protein kinase prp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp4 PE=1 SV=2 400 764 3.0E-43
sp|O35491|CLK2_MOUSE Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=1 SV=2 410 764 2.0E-41
sp|O35493|CLK4_MOUSE Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1 420 764 3.0E-41
sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1 410 764 7.0E-41
sp|Q9HAZ1|CLK4_HUMAN Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1 420 764 1.0E-40
sp|P49762|DOA_DROME Serine/threonine-protein kinase Doa OS=Drosophila melanogaster GN=Doa PE=1 SV=2 403 671 2.0E-40
sp|Q3SX21|CLK3_BOVIN Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1 403 766 2.0E-40
sp|Q63117|CLK3_RAT Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=1 SV=2 403 766 3.0E-40
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 423 643 2.0E-39
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 423 643 3.0E-39
sp|Q54UA9|CLKA_DICDI Probable serine/threonine-protein kinase clkA OS=Dictyostelium discoideum GN=clkA PE=3 SV=1 381 684 1.0E-38
sp|P32350|KNS1_YEAST Dual specificity protein kinase KNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KNS1 PE=1 SV=2 404 627 8.0E-35
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 424 659 3.0E-34
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 423 645 6.0E-34
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 431 645 5.0E-33
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 423 657 1.0E-32
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 423 657 1.0E-32
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 423 657 2.0E-32
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 413 651 3.0E-32
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 423 645 6.0E-32
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 423 645 6.0E-32
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 423 645 9.0E-32
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 431 666 1.0E-31
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 424 645 2.0E-31
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 424 645 2.0E-31
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 428 645 2.0E-31
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 423 650 6.0E-31
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 424 645 1.0E-30
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 431 645 1.0E-30
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 431 645 1.0E-30
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 397 645 1.0E-30
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 423 645 1.0E-30
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 425 645 2.0E-30
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 424 645 2.0E-30
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 424 645 2.0E-30
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 431 645 3.0E-30
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 422 650 4.0E-30
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 431 645 4.0E-30
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 421 651 4.0E-30
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 428 645 4.0E-30
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 431 645 5.0E-30
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 431 645 5.0E-30
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 423 765 6.0E-30
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 423 765 6.0E-30
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 424 645 7.0E-30
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 421 645 9.0E-30
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 431 645 1.0E-29
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 424 642 1.0E-29
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 424 652 1.0E-29
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 425 645 1.0E-29
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 425 645 1.0E-29
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 423 765 1.0E-29
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 425 645 1.0E-29
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 421 645 2.0E-29
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 424 645 2.0E-29
sp|Q9C5C0|MPK18_ARATH Mitogen-activated protein kinase 18 OS=Arabidopsis thaliana GN=MPK18 PE=1 SV=4 421 645 2.0E-29
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 421 645 2.0E-29
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 421 651 2.0E-29
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 424 645 3.0E-29
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 431 645 3.0E-29
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 424 645 3.0E-29
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 431 645 3.0E-29
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 430 645 3.0E-29
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 431 666 3.0E-29
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 423 645 3.0E-29
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 423 765 3.0E-29
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 424 652 4.0E-29
sp|Q9LUC3|MPK19_ARATH Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2 421 645 4.0E-29
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 419 645 4.0E-29
sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens GN=GSK3A PE=1 SV=2 425 645 5.0E-29
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 428 765 6.0E-29
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 421 651 6.0E-29
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 424 669 6.0E-29
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 422 645 7.0E-29
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 428 763 8.0E-29
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 425 645 9.0E-29
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 424 652 9.0E-29
sp|P18265|GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus GN=Gsk3a PE=1 SV=1 425 645 9.0E-29
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 425 645 9.0E-29
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 430 645 9.0E-29
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 424 652 9.0E-29
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 425 645 1.0E-28
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 424 645 1.0E-28
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 424 645 1.0E-28
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 430 645 1.0E-28
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 431 790 1.0E-28
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 424 645 1.0E-28
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 424 645 1.0E-28
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 424 645 1.0E-28
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 430 645 2.0E-28
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 431 790 2.0E-28
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 424 794 2.0E-28
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabidopsis thaliana GN=ASK2 PE=2 SV=1 430 645 2.0E-28
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 428 645 2.0E-28
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 424 652 2.0E-28
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 420 645 2.0E-28
sp|P83101|GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster GN=gskt PE=2 SV=1 430 645 2.0E-28
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 424 643 2.0E-28
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 424 643 2.0E-28
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 431 650 2.0E-28
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 428 763 2.0E-28
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 424 652 3.0E-28
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 424 652 3.0E-28
sp|O23236|MPK14_ARATH Mitogen-activated protein kinase 14 OS=Arabidopsis thaliana GN=MPK14 PE=1 SV=1 424 643 3.0E-28
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 424 652 3.0E-28
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 428 645 3.0E-28
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 424 645 4.0E-28
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3 403 645 4.0E-28
sp|Q9LM33|MPK8_ARATH Mitogen-activated protein kinase 8 OS=Arabidopsis thaliana GN=MPK8 PE=1 SV=2 421 646 4.0E-28
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 424 643 4.0E-28
sp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 9 OS=Arabidopsis thaliana GN=MPK9 PE=2 SV=2 421 646 4.0E-28
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 414 645 4.0E-28
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 424 652 4.0E-28
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 421 651 4.0E-28
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 424 643 5.0E-28
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 424 652 5.0E-28
sp|Q9U6D2|JNK1_ANCCA Stress-activated protein kinase JNK-1 OS=Ancylostoma caninum GN=JNK-1 PE=2 SV=2 424 645 5.0E-28
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 424 652 5.0E-28
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 424 645 6.0E-28
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 424 652 6.0E-28
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 424 652 7.0E-28
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 428 645 7.0E-28
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 424 643 8.0E-28
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2 425 645 8.0E-28
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 425 645 8.0E-28
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 424 652 8.0E-28
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 414 645 9.0E-28
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 399 645 9.0E-28
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 424 652 9.0E-28
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 424 652 9.0E-28
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 424 652 9.0E-28
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 424 645 1.0E-27
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 424 652 1.0E-27
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 414 645 1.0E-27
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 420 652 1.0E-27
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 430 645 1.0E-27
sp|Q8SR86|CDK1_ENCCU Cyclin-dependent kinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC28 PE=3 SV=1 428 667 1.0E-27
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 424 652 1.0E-27
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 414 645 1.0E-27
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 424 645 1.0E-27
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 424 652 2.0E-27
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 425 645 2.0E-27
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 425 645 2.0E-27
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 424 652 2.0E-27
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 424 652 2.0E-27
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 399 645 3.0E-27
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 414 645 3.0E-27
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 423 645 3.0E-27
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 418 645 3.0E-27
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 421 651 3.0E-27
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 431 645 3.0E-27
sp|Q8WQG9|JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans GN=jnk-1 PE=1 SV=2 424 650 3.0E-27
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 424 652 3.0E-27
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 423 645 3.0E-27
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 406 651 3.0E-27
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 421 650 3.0E-27
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 431 764 3.0E-27
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 431 764 3.0E-27
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 424 652 3.0E-27
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 414 645 3.0E-27
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 424 643 3.0E-27
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 424 652 3.0E-27
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 424 652 3.0E-27
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 424 652 3.0E-27
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 424 645 3.0E-27
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 424 652 4.0E-27
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 417 662 4.0E-27
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 424 645 4.0E-27
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 424 645 4.0E-27
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 424 652 5.0E-27
sp|Q9UQ07|MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens GN=MOK PE=2 SV=1 431 655 5.0E-27
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 424 646 5.0E-27
sp|P92208|JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster GN=bsk PE=1 SV=1 424 650 6.0E-27
sp|Q5I6M2|HOG1_SETTU Mitogen-activated protein kinase HOG1 OS=Setosphaeria turcica GN=HOG1 PE=2 SV=2 434 652 6.0E-27
sp|Q0E459|MPK13_ORYSJ Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. japonica GN=MPK13 PE=2 SV=1 421 645 7.0E-27
sp|A2X0M1|MPK13_ORYSI Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. indica GN=MPK13 PE=2 SV=2 421 645 7.0E-27
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 373 645 7.0E-27
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 373 645 7.0E-27
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 424 645 7.0E-27
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 428 766 7.0E-27
sp|Q40517|NTF3_TOBAC Mitogen-activated protein kinase homolog NTF3 OS=Nicotiana tabacum GN=NTF3 PE=1 SV=1 424 643 8.0E-27
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 425 645 8.0E-27
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 424 645 9.0E-27
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 421 646 9.0E-27
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 424 652 9.0E-27
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 415 645 1.0E-26
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 413 645 1.0E-26
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 415 645 1.0E-26
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 414 646 1.0E-26
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 430 645 1.0E-26
sp|P14681|KSS1_YEAST Mitogen-activated protein kinase KSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSS1 PE=1 SV=1 424 654 1.0E-26
sp|Q4PNJ1|HOG1_FUSCU Mitogen-activated protein kinase HOG1 (Fragment) OS=Fusarium culmorum GN=HOG1 PE=3 SV=1 451 652 1.0E-26
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 425 645 1.0E-26
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 430 645 2.0E-26
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 423 645 2.0E-26
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 428 645 2.0E-26
sp|Q4PKS0|HOG1_GIBIN Mitogen-activated protein kinase HOG1 (Fragment) OS=Gibberella intermedia GN=HOG1 PE=3 SV=1 451 652 2.0E-26
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 405 662 2.0E-26
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 415 645 2.0E-26
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 425 767 2.0E-26
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 431 718 2.0E-26
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 425 645 2.0E-26
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 431 790 2.0E-26
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 424 643 2.0E-26
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 424 666 3.0E-26
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 428 645 3.0E-26
sp|Q9WVS4|MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus GN=Mok PE=1 SV=1 431 655 3.0E-26
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 431 689 3.0E-26
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 425 647 3.0E-26
sp|A3EZ53|HOG1_WALMU Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia muriae GN=HOG1 PE=3 SV=1 487 794 3.0E-26
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 425 643 3.0E-26
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 425 645 3.0E-26
sp|P16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUS3 PE=1 SV=2 430 645 4.0E-26
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 417 662 4.0E-26
sp|Q39027|MPK7_ARATH Mitogen-activated protein kinase 7 OS=Arabidopsis thaliana GN=MPK7 PE=1 SV=2 424 643 4.0E-26
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 420 652 4.0E-26
sp|A3EZ54|HOG1_WALSE Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia sebi GN=HOG1 PE=3 SV=1 487 794 4.0E-26
sp|G5EFV5|CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans GN=cdk-7 PE=1 SV=1 424 645 4.0E-26
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 420 652 4.0E-26
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 421 645 4.0E-26
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 423 645 5.0E-26
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 424 652 5.0E-26
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 431 651 5.0E-26
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 405 645 6.0E-26
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 399 645 6.0E-26
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 425 665 6.0E-26
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 420 652 6.0E-26
sp|Q96WV9|CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdk9 PE=1 SV=1 416 645 6.0E-26
sp|P38615|RIM11_YEAST Serine/threonine-protein kinase RIM11/MSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM11 PE=1 SV=1 429 645 6.0E-26
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 422 645 6.0E-26
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 424 779 8.0E-26
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 425 643 8.0E-26
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 425 643 8.0E-26
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 422 645 8.0E-26
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 425 643 8.0E-26
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 431 651 8.0E-26
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 424 652 9.0E-26
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 431 645 9.0E-26
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 420 652 1.0E-25
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 414 685 1.0E-25
sp|Q3V3A1|CDK15_MOUSE Cyclin-dependent kinase 15 OS=Mus musculus GN=Cdk15 PE=2 SV=2 425 645 1.0E-25
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 425 645 1.0E-25
sp|Q388M1|GSK3B_TRYB2 Glycogen synthase kinase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GSK3 PE=1 SV=1 420 645 1.0E-25
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 431 688 1.0E-25
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 420 652 1.0E-25
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 417 646 1.0E-25
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 425 645 1.0E-25
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 417 645 1.0E-25
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 431 651 2.0E-25
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 431 713 2.0E-25
sp|P0CP66|CPK1_CRYNJ Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPK1 PE=3 SV=1 425 651 2.0E-25
sp|P0CP67|CPK1_CRYNB Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPK1 PE=3 SV=1 425 651 2.0E-25
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 420 652 2.0E-25
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 417 645 2.0E-25
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 420 652 2.0E-25
sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 413 645 2.0E-25
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 431 667 2.0E-25
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 422 645 2.0E-25
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 424 643 2.0E-25
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 422 645 2.0E-25
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 425 645 3.0E-25
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 425 645 3.0E-25
sp|P39745|MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans GN=mpk-1 PE=1 SV=2 424 645 3.0E-25
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 420 652 3.0E-25
sp|Q39021|MPK1_ARATH Mitogen-activated protein kinase 1 OS=Arabidopsis thaliana GN=MPK1 PE=1 SV=2 424 643 3.0E-25
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 420 652 3.0E-25
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 424 643 4.0E-25
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 431 646 4.0E-25
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 424 643 4.0E-25
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 424 666 4.0E-25
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 431 646 5.0E-25
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 431 646 5.0E-25
sp|Q40884|MPK_PETHY Mitogen-activated protein kinase homolog 1 OS=Petunia hybrida GN=MPK1 PE=2 SV=1 424 643 5.0E-25
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 424 645 5.0E-25
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 431 650 5.0E-25
sp|Q84M93|MPK17_ARATH Mitogen-activated protein kinase 17 OS=Arabidopsis thaliana GN=MPK17 PE=2 SV=1 421 649 6.0E-25
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 431 646 6.0E-25
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 424 645 6.0E-25
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 422 767 6.0E-25
sp|O44514|PMK3_CAEEL Mitogen-activated protein kinase pmk-3 OS=Caenorhabditis elegans GN=pmk-3 PE=1 SV=2 389 764 7.0E-25
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 425 645 7.0E-25
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 413 645 7.0E-25
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 417 645 7.0E-25
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 413 645 7.0E-25
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 424 645 7.0E-25
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 430 645 7.0E-25
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 431 646 8.0E-25
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 421 645 8.0E-25
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 431 646 8.0E-25
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 424 645 8.0E-25
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 425 645 9.0E-25
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 430 652 1.0E-24
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 424 643 1.0E-24
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 424 645 1.0E-24
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 425 645 1.0E-24
sp|Q6BV06|BUR1_DEBHA Serine/threonine-protein kinase BUR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BUR1 PE=3 SV=1 413 649 1.0E-24
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 417 645 1.0E-24
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 424 779 1.0E-24
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 431 645 1.0E-24
sp|Q9I958|MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio GN=mapk14b PE=1 SV=1 431 651 2.0E-24
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 424 645 2.0E-24
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 428 645 2.0E-24
sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinase OS=Fusarium solani subsp. pisi GN=MAPK PE=2 SV=1 424 647 2.0E-24
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 424 645 2.0E-24
sp|Q9DGE1|MK14B_DANRE Mitogen-activated protein kinase 14B OS=Danio rerio GN=mapk14b PE=1 SV=1 499 651 2.0E-24
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 420 652 2.0E-24
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 417 646 2.0E-24
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 428 649 2.0E-24
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 425 645 3.0E-24
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 425 645 3.0E-24
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 425 645 3.0E-24
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 425 645 3.0E-24
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 424 643 3.0E-24
sp|Q96VK3|BUR1_EMENI Serine/threonine-protein kinase bur1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ptkA PE=2 SV=1 416 645 3.0E-24
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 425 645 4.0E-24
sp|O61847|CDK2_CAEEL Cyclin-dependent kinase 2 OS=Caenorhabditis elegans GN=cdk-2 PE=1 SV=2 424 645 4.0E-24
sp|Q9Y7W4|BUR1_CANAL Serine/threonine-protein kinase BUR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRK1 PE=3 SV=2 425 645 4.0E-24
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 431 650 5.0E-24
sp|Q96Q40|CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens GN=CDK15 PE=1 SV=2 392 645 5.0E-24
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 417 645 5.0E-24
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 417 645 5.0E-24
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 417 645 5.0E-24
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 431 650 5.0E-24
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 417 645 5.0E-24
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 425 645 5.0E-24
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 424 645 6.0E-24
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 417 645 6.0E-24
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 424 645 6.0E-24
sp|Q9WUI1|MK11_MOUSE Mitogen-activated protein kinase 11 OS=Mus musculus GN=Mapk11 PE=1 SV=2 431 645 7.0E-24
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 417 645 7.0E-24
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 431 645 7.0E-24
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 420 652 7.0E-24
sp|Q9DGD9|MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio GN=mapk8 PE=2 SV=1 503 645 7.0E-24
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 404 650 8.0E-24
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 431 666 8.0E-24
sp|Q15759|MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens GN=MAPK11 PE=1 SV=2 431 645 8.0E-24
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 424 643 9.0E-24
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 420 650 9.0E-24
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 431 645 9.0E-24
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 420 650 9.0E-24
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 413 654 1.0E-23
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 424 645 1.0E-23
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 431 645 1.0E-23
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 424 645 1.0E-23
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 422 651 1.0E-23
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 422 651 1.0E-23
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 422 651 1.0E-23
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 422 651 1.0E-23
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 422 651 1.0E-23
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 428 645 2.0E-23
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 428 645 2.0E-23
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 425 645 2.0E-23
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 386 645 2.0E-23
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 424 645 2.0E-23
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 424 643 3.0E-23
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 422 767 3.0E-23
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 425 645 3.0E-23
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 431 645 3.0E-23
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 431 650 3.0E-23
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 422 651 4.0E-23
sp|Q6ZAG3|CDKC3_ORYSJ Cyclin-dependent kinase C-3 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=3 SV=2 431 645 4.0E-23
sp|O42099|MK08B_CYPCA Mitogen-activated protein kinase 8B OS=Cyprinus carpio GN=mapk8b PE=2 SV=1 431 645 4.0E-23
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 449 645 5.0E-23
sp|Q38775|CDC2D_ANTMA Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1 425 645 5.0E-23
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 424 653 5.0E-23
sp|P50873|MRK1_YEAST Serine/threonine-protein kinase MRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRK1 PE=1 SV=2 429 645 6.0E-23
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 449 645 6.0E-23
sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1 418 645 7.0E-23
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 425 645 7.0E-23
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 425 645 7.0E-23
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 431 645 8.0E-23
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 417 647 8.0E-23
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 424 646 1.0E-22
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 431 645 1.0E-22
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 422 651 1.0E-22
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 396 645 1.0E-22
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 422 651 1.0E-22
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 425 645 1.0E-22
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 424 645 1.0E-22
sp|Q966Y3|JNK_SUBDO Stress-activated protein kinase JNK OS=Suberites domuncula GN=JNK PE=2 SV=1 424 765 1.0E-22
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 436 666 1.0E-22
sp|Q9XTR1|CDK4_CAEEL Cyclin-dependent kinase 4 homolog OS=Caenorhabditis elegans GN=cdk-4 PE=1 SV=2 426 645 2.0E-22
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 425 673 2.0E-22
sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=4 418 645 2.0E-22
sp|Q4I5U9|BUR1_GIBZE Serine/threonine-protein kinase BUR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BUR1 PE=3 SV=2 425 645 3.0E-22
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 425 645 3.0E-22
sp|P24788|CD11B_MOUSE Cyclin-dependent kinase 11B OS=Mus musculus GN=Cdk11b PE=1 SV=2 418 645 3.0E-22
sp|Q871M9|BUR1_NEUCR Serine/threonine-protein kinase bur1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-1 PE=3 SV=2 416 645 4.0E-22
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 424 645 4.0E-22
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 425 645 4.0E-22
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 425 645 4.0E-22
sp|P21127|CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens GN=CDK11B PE=1 SV=3 418 645 4.0E-22
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 425 645 5.0E-22
sp|Q8SR90|Y8H9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1790 PE=3 SV=1 424 645 5.0E-22
sp|P32581|IME2_YEAST Meiosis induction protein kinase IME2/SME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IME2 PE=3 SV=1 487 645 5.0E-22
sp|Q8MXI4|PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans GN=pmk-2 PE=3 SV=1 431 645 5.0E-22
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 428 645 5.0E-22
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 425 645 6.0E-22
sp|P49187|MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus GN=Mapk10 PE=1 SV=2 449 645 7.0E-22
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1 428 645 7.0E-22
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 425 660 8.0E-22
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 417 662 9.0E-22
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 417 645 1.0E-21
sp|P45983|MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens GN=MAPK8 PE=1 SV=2 431 645 1.0E-21
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 449 645 1.0E-21
sp|P49185|MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus GN=Mapk8 PE=1 SV=1 431 645 1.0E-21
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 424 645 2.0E-21
sp|P79996|MK09_CHICK Mitogen-activated protein kinase 9 OS=Gallus gallus GN=MAPK9 PE=2 SV=1 424 645 2.0E-21
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 424 643 2.0E-21
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 425 645 2.0E-21
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 427 645 2.0E-21
sp|F4I114|Y1960_ARATH Probable serine/threonine-protein kinase At1g09600 OS=Arabidopsis thaliana GN=At1g09600 PE=3 SV=1 413 645 2.0E-21
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 425 648 3.0E-21
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 425 645 3.0E-21
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 424 638 4.0E-21
sp|P53779|MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens GN=MAPK10 PE=1 SV=2 449 645 4.0E-21
sp|Q12126|CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crk1 PE=1 SV=1 431 661 4.0E-21
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 425 649 5.0E-21
sp|Q55GS4|CDK10_DICDI Probable cyclin-dependent kinase 10 OS=Dictyostelium discoideum GN=cdk10 PE=2 SV=1 428 645 5.0E-21
sp|P45984|MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens GN=MAPK9 PE=1 SV=2 424 645 5.0E-21
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 425 645 6.0E-21
sp|P49186|MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus GN=Mapk9 PE=1 SV=1 424 645 7.0E-21
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 425 645 7.0E-21
sp|Q12222|YGK3_YEAST Glycogen synthase kinase-3 homolog YGK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGK3 PE=1 SV=1 506 656 8.0E-21
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 424 645 1.0E-20
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 425 648 1.0E-20
sp|P25859|CKB11_ARATH Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2 424 645 1.0E-20
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 425 649 1.0E-20
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 425 678 2.0E-20
sp|Q8SW92|KIN28_ENCCU Probable serine/threonine-protein kinase KIN28 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN28 PE=3 SV=1 449 645 2.0E-20
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 417 765 2.0E-20
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 431 765 2.0E-20
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 499 650 2.0E-20
sp|Q38774|CDC2C_ANTMA Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1 424 645 3.0E-20
sp|P43068|MKC1_CANAX Mitogen-activated protein kinase MKC1 OS=Candida albicans GN=MKC1 PE=3 SV=1 499 650 3.0E-20
sp|P46892|CD11B_RAT Cyclin-dependent kinase 11B OS=Rattus norvegicus GN=Cdk11b PE=1 SV=1 418 645 3.0E-20
sp|Q92398|SPM1_SCHPO Mitogen-activated protein kinase spm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm1 PE=1 SV=1 431 645 4.0E-20
sp|Q91Y86|MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus GN=Mapk8 PE=1 SV=1 424 645 4.0E-20
sp|Q4WTN5|BUR1_ASPFU Serine/threonine-protein kinase bur1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bur1 PE=3 SV=1 418 645 6.0E-20
sp|Q1EBK0|SSN3_COCIM Serine/threonine-protein kinase SSN3 OS=Coccidioides immitis (strain RS) GN=SSN3 PE=3 SV=3 424 645 7.0E-20
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 425 646 8.0E-20
sp|Q0TWJ7|SSN3_PHANO Serine/threonine-protein kinase SSN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SSN3 PE=3 SV=1 423 645 9.0E-20
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 425 646 1.0E-19
sp|Q5SUV5|MYLK4_MOUSE Myosin light chain kinase family member 4 OS=Mus musculus GN=Mylk4 PE=1 SV=2 429 639 1.0E-19
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 425 646 1.0E-19
sp|Q4WUN7|MPKC_ASPFU Mitogen-activated protein kinase mpkC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpkC PE=2 SV=2 417 662 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0043248 proteasome assembly Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0097159 organic cyclic compound binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0006793 phosphorus metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:1901564 organonitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0043933 protein-containing complex organization No
GO:0017076 purine nucleotide binding No
GO:0044238 primary metabolic process No
GO:0000166 nucleotide binding No
GO:0065003 protein-containing complex assembly No
GO:0140096 catalytic activity, acting on a protein No
GO:0022607 cellular component assembly No
GO:0032555 purine ribonucleotide binding No
GO:0016043 cellular component organization No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016310 phosphorylation No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042610
MPGMVVEVIELVDSYMVWVGVAESAETAETASLQGRLCKNWAYAMPPREGEDTGAGIWLFRSEDSDGGLSMARRL
AKRLGKAMAVSVDGGVEMMVAERGIFDLPRWHTAHSLFPTEQHATLAGASSARRHSLLADSDSHPMQPQSAFYPP
PPHFQPPNSAPSESFPDVYYPKRIPDPNPPPPAAASRSPMRMQTTPLLDPYAPQQAQYSPSTQYQYPAPAQQQYA
HNRTISHPKQEPITPPVSQSYASPPSAHPSSSSYAPPFAMDTASPHPPQSHLAAQPSSRSHSHSNPSTPISYPHG
PHTPSTRYYTPESQMVVDPPPKRRASGFRRVRTVHDLQPRVEGNSAARRVTSDGIYLSPLRQLTTNLVETYHICN
PQFRYESAHNPRRVLTKPSKPAHNDGYDNEDYDYVLYVNDWLGTEEGHKYLILDILGQGTFGQVVKCQNMKTHEI
VAVKVVKNKPAYFNQSMMEVTILELLNKNFDPTDEHHILRLQDSFIHRNHLCLVFELLSSNLYELIKQNQFQGLS
TQLVKVFMAQLLDALTVLKDARLIHCDLKPENILLKSLQSPQIKIIDFGSACHERQTVYTYIQSRFYRSPEVLLG
MSYTASIDMWSLGCIAVELFLGLPLFPGTSEYNQLTRIIEMLGMPPLSMLNTGKQVGQFFDSYEVWNAHTSQNER
KYKMKSMEQYSREHGTNEQPGKQYFKATTLQDIINTAPIPQVKSSRCSGNEVEKEMANRAAFIDFCQGLLNLNPV
TRWTPQQARMHPFITGEKFTKPFVPDNPIMVSHMSPSISDSKRPYGGLVPPAPKGQRPIFDAAAYNHQLAQHQAY
TAQVASQAANVTRNPYIVTHPPQQASGQAPPSYQNSPDANVVPYQPQQHHSHAHAQYAGQNASRGLSHQSSAGQL
ASNAGSAPGPAAGPYAAGGGANQPHIKPSSGSGGAPASATYYPNSRARANTINQMDTVPPALARLQHMNQDVIGG
RNALTPVLNRDDALKEWERRQQGGQPAQVQPYPQLEYLQQQAEMASAGGLSGWGANVAAAALGMHPHAHNHRYPP
PPSKLSQSYHPQTLLVDDDRREAIMSNVRAIARGDNPGQQGQQQQSIGGAQQVPPPPPQSGGLYGSAGGGNRYAA
AYGGPQAPPPQSQQQQQQQQQQQQQQHQVNGGNGTGVPSFDSIDRRGDMGSMYVPMQPDNYHQQHHQHQYAGSGN
SAPQATPRHMVAPPQQAAAPSFYGAGIVPSGVAQPHSQQGQPGQVQQGQQGHQQRNPFTSMQMPDNGVGMGGIGK
PDVRRGNGMDAWPR*
Coding >AgabiH97|042610
ATGCCAGGGATGGTGGTGGAGGTGATCGAGCTAGTAGATTCGTATATGGTGTGGGTAGGAGTGGCAGAGTCTGCG
GAGACTGCGGAGACGGCGTCCCTCCAGGGGCGCCTGTGCAAGAACTGGGCATATGCGATGCCGCCGCGAGAGGGC
GAAGACACGGGGGCGGGCATCTGGCTCTTCCGATCAGAAGACTCGGACGGGGGGCTATCGATGGCGCGGCGACTC
GCGAAACGACTGGGAAAGGCGATGGCAGTGTCTGTGGATGGTGGGGTAGAGATGATGGTAGCGGAGAGGGGAATT
TTCGACCTTCCCCGCTGGCACACCGCACACTCGCTCTTTCCCACTGAGCAGCACGCCACGCTCGCCGGCGCATCC
TCCGCTCGCCGCCACTCCCTCCTCGCTGACTCAGACTCGCACCCCATGCAGCCTCAGTCCGCCTTTTATCCTCCG
CCACCCCACTTCCAGCCACCCAACTCCGCCCCCTCCGAGTCTTTCCCCGACGTCTACTACCCAAAACGCATCCCG
GATCCCAATCCTCCTCCCCCCGCCGCCGCCTCCAGATCGCCCATGCGCATGCAGACCACCCCGCTCCTCGATCCC
TATGCCCCCCAGCAGGCCCAGTACTCTCCCAGCACCCAGTACCAGTATCCAGCCCCAGCCCAGCAACAGTACGCA
CACAATCGCACCATCTCCCATCCAAAGCAGGAGCCCATCACGCCCCCCGTCTCCCAGTCCTATGCATCGCCACCC
TCTGCCCACCCCTCCTCCTCCTCCTACGCACCTCCCTTTGCCATGGACACAGCCAGCCCCCATCCACCCCAGTCC
CATCTTGCCGCACAACCTTCCTCTCGGTCCCATTCGCATTCCAACCCATCCACTCCCATCTCCTACCCGCATGGT
CCACACACCCCCAGCACTCGATATTACACTCCAGAGTCCCAAATGGTCGTCGATCCCCCTCCAAAACGTCGAGCT
TCCGGTTTTCGTCGTGTCCGCACCGTTCACGATCTCCAGCCTCGTGTCGAGGGCAACTCGGCCGCCCGGCGTGTA
ACCTCTGATGGTATCTATCTTTCCCCTCTACGCCAGTTGACTACCAATCTTGTCGAAACCTATCACATCTGCAAC
CCCCAGTTCAGATACGAATCCGCCCACAACCCAAGGCGTGTCCTTACAAAGCCAAGCAAGCCCGCACACAACGAT
GGCTACGATAACGAGGACTATGATTACGTTCTCTACGTCAACGACTGGCTGGGTACCGAAGAAGGCCACAAGTAT
CTGATCCTCGACATCCTCGGTCAAGGCACCTTTGGTCAGGTGGTAAAGTGCCAAAACATGAAAACGCACGAGATC
GTCGCCGTCAAGGTAGTCAAAAACAAACCCGCTTATTTCAATCAGAGTATGATGGAAGTTACCATTTTGGAGCTC
TTGAACAAGAATTTTGACCCCACTGATGAGCATCACATCCTCCGACTACAGGACTCGTTCATCCATAGAAACCAT
CTCTGTCTTGTTTTTGAGCTTTTGTCTTCAAACCTCTACGAACTGATCAAGCAAAATCAATTCCAGGGCCTGAGC
ACCCAGCTTGTTAAAGTCTTCATGGCGCAGTTATTGGATGCCTTGACCGTACTCAAAGACGCTCGGCTCATTCAC
TGCGATCTCAAACCAGAAAATATTCTCCTAAAATCATTGCAGTCACCTCAAATAAAAATCATTGATTTTGGTTCT
GCGTGCCACGAGCGACAGACTGTCTATACATACATTCAATCTCGGTTCTATCGGTCACCAGAGGTGCTGTTAGGG
ATGTCGTATACGGCCTCCATTGACATGTGGTCATTGGGCTGCATTGCTGTTGAACTATTCCTTGGGCTTCCGTTG
TTTCCGGGAACAAGCGAGTATAACCAATTGACTAGAATCATTGAAATGCTTGGTATGCCGCCGCTGAGTATGTTG
AACACTGGCAAACAAGTCGGTCAGTTTTTCGACTCTTACGAGGTTTGGAATGCACATACAAGTCAAAACGAACGG
AAATACAAAATGAAGTCCATGGAGCAATATTCCAGGGAACACGGGACTAATGAACAACCTGGGAAACAGTATTTC
AAGGCAACGACGCTGCAGGATATCATTAATACGGCTCCCATACCCCAAGTCAAATCGTCGAGATGTTCGGGCAAC
GAGGTGGAGAAAGAAATGGCGAATCGCGCCGCATTCATCGACTTTTGCCAAGGTCTTCTGAACCTCAACCCAGTT
ACACGCTGGACTCCTCAACAGGCGAGGATGCACCCCTTCATCACGGGAGAAAAATTCACAAAGCCATTCGTCCCT
GACAACCCAATTATGGTCTCACATATGTCGCCGTCAATCTCCGATTCGAAGAGACCGTATGGTGGCTTGGTGCCT
CCCGCACCAAAAGGGCAGAGACCCATCTTTGATGCCGCGGCTTATAATCACCAACTGGCTCAACATCAAGCTTAT
ACGGCGCAGGTCGCGAGTCAAGCTGCAAATGTCACACGGAACCCTTATATAGTCACTCATCCTCCCCAACAAGCA
TCAGGTCAAGCCCCTCCGTCGTATCAAAATTCACCGGACGCCAACGTCGTTCCTTATCAACCACAACAACACCAC
TCCCATGCGCATGCTCAGTACGCAGGACAAAATGCTAGTAGGGGACTTTCTCATCAAAGTTCAGCTGGGCAACTG
GCGAGTAATGCTGGTTCTGCACCTGGCCCTGCTGCTGGCCCTTATGCTGCTGGCGGAGGTGCCAATCAGCCACAC
ATCAAACCTTCCTCTGGATCTGGCGGTGCCCCTGCTTCCGCAACTTATTATCCTAATTCACGTGCTCGAGCCAAC
ACAATTAACCAGATGGATACTGTGCCTCCCGCATTGGCCCGGTTGCAGCATATGAATCAAGACGTCATCGGCGGA
AGGAACGCGTTGACACCTGTTTTGAACCGGGATGATGCTCTGAAAGAGTGGGAGAGGAGGCAACAAGGAGGACAA
CCTGCGCAGGTGCAACCGTATCCACAATTGGAGTATTTGCAGCAACAAGCTGAGATGGCTTCTGCTGGCGGTTTA
AGTGGATGGGGTGCTAATGTGGCTGCTGCTGCTTTGGGCATGCACCCTCATGCACATAATCATCGGTATCCCCCT
CCTCCCAGTAAACTCTCTCAATCTTATCATCCACAAACGCTGCTAGTCGACGATGACAGGCGGGAAGCAATCATG
TCAAATGTGAGGGCTATAGCAAGAGGGGATAATCCAGGTCAACAAGGACAACAGCAACAATCGATTGGGGGGGCA
CAGCAAGTACCTCCGCCTCCACCACAAAGTGGAGGGTTGTACGGTTCTGCTGGTGGAGGAAATCGATATGCGGCG
GCGTATGGTGGCCCACAAGCACCTCCACCTCAATCACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAA
CAACATCAGGTCAACGGGGGGAATGGAACTGGTGTACCTTCGTTTGATTCGATTGATAGAAGGGGTGATATGGGG
AGCATGTATGTCCCTATGCAACCGGACAATTATCATCAGCAACATCATCAACATCAGTATGCTGGTTCTGGCAAT
TCCGCACCTCAAGCTACTCCTCGGCATATGGTTGCCCCGCCTCAACAAGCGGCAGCACCTTCGTTCTATGGGGCT
GGAATTGTACCAAGTGGCGTCGCACAACCGCATTCACAGCAAGGACAGCCAGGACAAGTGCAACAGGGACAGCAA
GGACATCAACAGAGGAACCCGTTTACGTCGATGCAGATGCCAGATAATGGGGTTGGAATGGGAGGAATTGGAAAA
CCTGATGTACGGAGAGGTAATGGGATGGATGCCTGGCCCAGATGA
Transcript >AgabiH97|042610
ATGCCAGGGATGGTGGTGGAGGTGATCGAGCTAGTAGATTCGTATATGGTGTGGGTAGGAGTGGCAGAGTCTGCG
GAGACTGCGGAGACGGCGTCCCTCCAGGGGCGCCTGTGCAAGAACTGGGCATATGCGATGCCGCCGCGAGAGGGC
GAAGACACGGGGGCGGGCATCTGGCTCTTCCGATCAGAAGACTCGGACGGGGGGCTATCGATGGCGCGGCGACTC
GCGAAACGACTGGGAAAGGCGATGGCAGTGTCTGTGGATGGTGGGGTAGAGATGATGGTAGCGGAGAGGGGAATT
TTCGACCTTCCCCGCTGGCACACCGCACACTCGCTCTTTCCCACTGAGCAGCACGCCACGCTCGCCGGCGCATCC
TCCGCTCGCCGCCACTCCCTCCTCGCTGACTCAGACTCGCACCCCATGCAGCCTCAGTCCGCCTTTTATCCTCCG
CCACCCCACTTCCAGCCACCCAACTCCGCCCCCTCCGAGTCTTTCCCCGACGTCTACTACCCAAAACGCATCCCG
GATCCCAATCCTCCTCCCCCCGCCGCCGCCTCCAGATCGCCCATGCGCATGCAGACCACCCCGCTCCTCGATCCC
TATGCCCCCCAGCAGGCCCAGTACTCTCCCAGCACCCAGTACCAGTATCCAGCCCCAGCCCAGCAACAGTACGCA
CACAATCGCACCATCTCCCATCCAAAGCAGGAGCCCATCACGCCCCCCGTCTCCCAGTCCTATGCATCGCCACCC
TCTGCCCACCCCTCCTCCTCCTCCTACGCACCTCCCTTTGCCATGGACACAGCCAGCCCCCATCCACCCCAGTCC
CATCTTGCCGCACAACCTTCCTCTCGGTCCCATTCGCATTCCAACCCATCCACTCCCATCTCCTACCCGCATGGT
CCACACACCCCCAGCACTCGATATTACACTCCAGAGTCCCAAATGGTCGTCGATCCCCCTCCAAAACGTCGAGCT
TCCGGTTTTCGTCGTGTCCGCACCGTTCACGATCTCCAGCCTCGTGTCGAGGGCAACTCGGCCGCCCGGCGTGTA
ACCTCTGATGGTATCTATCTTTCCCCTCTACGCCAGTTGACTACCAATCTTGTCGAAACCTATCACATCTGCAAC
CCCCAGTTCAGATACGAATCCGCCCACAACCCAAGGCGTGTCCTTACAAAGCCAAGCAAGCCCGCACACAACGAT
GGCTACGATAACGAGGACTATGATTACGTTCTCTACGTCAACGACTGGCTGGGTACCGAAGAAGGCCACAAGTAT
CTGATCCTCGACATCCTCGGTCAAGGCACCTTTGGTCAGGTGGTAAAGTGCCAAAACATGAAAACGCACGAGATC
GTCGCCGTCAAGGTAGTCAAAAACAAACCCGCTTATTTCAATCAGAGTATGATGGAAGTTACCATTTTGGAGCTC
TTGAACAAGAATTTTGACCCCACTGATGAGCATCACATCCTCCGACTACAGGACTCGTTCATCCATAGAAACCAT
CTCTGTCTTGTTTTTGAGCTTTTGTCTTCAAACCTCTACGAACTGATCAAGCAAAATCAATTCCAGGGCCTGAGC
ACCCAGCTTGTTAAAGTCTTCATGGCGCAGTTATTGGATGCCTTGACCGTACTCAAAGACGCTCGGCTCATTCAC
TGCGATCTCAAACCAGAAAATATTCTCCTAAAATCATTGCAGTCACCTCAAATAAAAATCATTGATTTTGGTTCT
GCGTGCCACGAGCGACAGACTGTCTATACATACATTCAATCTCGGTTCTATCGGTCACCAGAGGTGCTGTTAGGG
ATGTCGTATACGGCCTCCATTGACATGTGGTCATTGGGCTGCATTGCTGTTGAACTATTCCTTGGGCTTCCGTTG
TTTCCGGGAACAAGCGAGTATAACCAATTGACTAGAATCATTGAAATGCTTGGTATGCCGCCGCTGAGTATGTTG
AACACTGGCAAACAAGTCGGTCAGTTTTTCGACTCTTACGAGGTTTGGAATGCACATACAAGTCAAAACGAACGG
AAATACAAAATGAAGTCCATGGAGCAATATTCCAGGGAACACGGGACTAATGAACAACCTGGGAAACAGTATTTC
AAGGCAACGACGCTGCAGGATATCATTAATACGGCTCCCATACCCCAAGTCAAATCGTCGAGATGTTCGGGCAAC
GAGGTGGAGAAAGAAATGGCGAATCGCGCCGCATTCATCGACTTTTGCCAAGGTCTTCTGAACCTCAACCCAGTT
ACACGCTGGACTCCTCAACAGGCGAGGATGCACCCCTTCATCACGGGAGAAAAATTCACAAAGCCATTCGTCCCT
GACAACCCAATTATGGTCTCACATATGTCGCCGTCAATCTCCGATTCGAAGAGACCGTATGGTGGCTTGGTGCCT
CCCGCACCAAAAGGGCAGAGACCCATCTTTGATGCCGCGGCTTATAATCACCAACTGGCTCAACATCAAGCTTAT
ACGGCGCAGGTCGCGAGTCAAGCTGCAAATGTCACACGGAACCCTTATATAGTCACTCATCCTCCCCAACAAGCA
TCAGGTCAAGCCCCTCCGTCGTATCAAAATTCACCGGACGCCAACGTCGTTCCTTATCAACCACAACAACACCAC
TCCCATGCGCATGCTCAGTACGCAGGACAAAATGCTAGTAGGGGACTTTCTCATCAAAGTTCAGCTGGGCAACTG
GCGAGTAATGCTGGTTCTGCACCTGGCCCTGCTGCTGGCCCTTATGCTGCTGGCGGAGGTGCCAATCAGCCACAC
ATCAAACCTTCCTCTGGATCTGGCGGTGCCCCTGCTTCCGCAACTTATTATCCTAATTCACGTGCTCGAGCCAAC
ACAATTAACCAGATGGATACTGTGCCTCCCGCATTGGCCCGGTTGCAGCATATGAATCAAGACGTCATCGGCGGA
AGGAACGCGTTGACACCTGTTTTGAACCGGGATGATGCTCTGAAAGAGTGGGAGAGGAGGCAACAAGGAGGACAA
CCTGCGCAGGTGCAACCGTATCCACAATTGGAGTATTTGCAGCAACAAGCTGAGATGGCTTCTGCTGGCGGTTTA
AGTGGATGGGGTGCTAATGTGGCTGCTGCTGCTTTGGGCATGCACCCTCATGCACATAATCATCGGTATCCCCCT
CCTCCCAGTAAACTCTCTCAATCTTATCATCCACAAACGCTGCTAGTCGACGATGACAGGCGGGAAGCAATCATG
TCAAATGTGAGGGCTATAGCAAGAGGGGATAATCCAGGTCAACAAGGACAACAGCAACAATCGATTGGGGGGGCA
CAGCAAGTACCTCCGCCTCCACCACAAAGTGGAGGGTTGTACGGTTCTGCTGGTGGAGGAAATCGATATGCGGCG
GCGTATGGTGGCCCACAAGCACCTCCACCTCAATCACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAA
CAACATCAGGTCAACGGGGGGAATGGAACTGGTGTACCTTCGTTTGATTCGATTGATAGAAGGGGTGATATGGGG
AGCATGTATGTCCCTATGCAACCGGACAATTATCATCAGCAACATCATCAACATCAGTATGCTGGTTCTGGCAAT
TCCGCACCTCAAGCTACTCCTCGGCATATGGTTGCCCCGCCTCAACAAGCGGCAGCACCTTCGTTCTATGGGGCT
GGAATTGTACCAAGTGGCGTCGCACAACCGCATTCACAGCAAGGACAGCCAGGACAAGTGCAACAGGGACAGCAA
GGACATCAACAGAGGAACCCGTTTACGTCGATGCAGATGCCAGATAATGGGGTTGGAATGGGAGGAATTGGAAAA
CCTGATGTACGGAGAGGTAATGGGATGGATGCCTGGCCCAGATGA
Gene >AgabiH97|042610
ATGCCAGGGATGGTGGTGGAGGTGATCGAGCTAGTAGATTCGTATATGGTGTGGGTAGGAGTGGCAGAGTCTGCG
GAGACTGCGGAGACGGCGTCCCTCCAGGGGCGCCTGTGCAAGAACTGGGCATATGCGATGCCGCCGCGAGAGGTG
CGTGGATGAAGTGTGTACTGAGCGAGACTGAGGATGTGCAGGGCGAAGACACGGGGGCGGGCATCTGGCTCTTCC
GATCAGAAGACTCGGACGGGGGGCTATCGATGGCGCGGCGACTCGGTGAGTGGGTCGGTATGCAGAGCGTAGACA
TGGCTGACGACGGGGCAGCGAAACGACTGGGAAAGGCGATGGCAGTGTCTGTGGATGGTGGGGTAGAGATGATGG
TAGCGGAGAGGGGAATTGTAGGGCTGTTGGTAGTAAATAGGGACTCTTAATGCCAGACACCAACGACCAGTTCGA
CCTTCCCCGCTGGCACACCGCACACTCGCTCTTTCCCACTGAGCAGCACGCCACGCTCGCCGGCGCATCCTCCGC
TCGCCGCCACTCCCTCCTCGCTGACTCAGACTCGCACCCCATGCAGCCTCAGTCCGCCTTTTATCCTCCGCCACC
CCACTTCCAGCCACCCAACTCCGCCCCCTCCGAGTCTTTCCCCGACGTCTACTACCCAAAACGCATCCCGGATCC
CAATCCTCCTCCCCCCGCCGCCGCCTCCAGATCGCCCATGCGCATGCAGACCACCCCGCTCCTCGATCCCTATGC
CCCCCAGCAGGCCCAGTACTCTCCCAGCACCCAGTACCAGTATCCAGCCCCAGCCCAGCAACAGTACGCACACAA
TCGCACCATCTCCCATCCAAAGCAGGAGCCCATCACGCCCCCCGTCTCCCAGTCCTATGCATCGCCACCCTCTGC
CCACCCCTCCTCCTCCTCCTACGCACCTCCCTTTGCCATGGACACAGCCAGCCCCCATCCACCCCAGTCCCATCT
TGCCGCACAACCTTCCTCTCGGTCCCATTCGCATTCCAACCCATCCACTCCCATCTCCTACCCGCATGGTCCACA
CACCCCCAGCACTCGATATTACACTCCAGAGTCCCAAATGGTCGTCGATCCCCCTCCAAAACGTCGAGCTTCCGG
TTTTCGTCGTGTCCGCACCGTTCACGATCTCCAGCCTCGTGTCGAGGGCAACTCGGCCGCCCGGCGTGTAACCTC
TGATGGTATCTATCTTTCCGTGCGTTTTCACCATCCTTTTTTTAAAGCAGCATTTCTCATCCTATTTCATAGCCT
CTACGCCAGTTGACTACCAATCTTGTCGAAACCTATCACATCTGCAACCCCCAGTTCAGATACGAATCCGCCCAC
AACCCAAGGCGTGTCCTTACAAAGCCAAGCAAGCCCGCACACAACGATGGCTACGATAACGAGGACTATGATTAC
GTTCTCTACGTCAACGACTGGCTGGGTACCGAAGAAGGCCACAAGTCAGCTTTTGTTCTCCTTTGTGTGGCGGCT
TTCTGACATGGCCTCCCTAGGTATCTGATCCTCGACATCCTCGGTCAAGGCACCTTTGGTCAGGTGGTAAAGTGC
CAAAACATGAAAACGCACGAGATCGTCGCCGTCAAGGTAGTCAAAAACAAACCCGCTTATTTCAATCAGAGTATG
ATGGAAGTTACCATTTTGGAGCTCGTGCGTGGATTCGCCTACTTATCCCTCTTTCGATCTCACATACTCTCTCTA
GTTGAACAAGAATTTTGACCCCACTGATGAGCATCACATCCTCCGACTACAGGACTCGTTCATCCATAGAAACCA
TCTCTGTCTTGTTTTTGAGCTTTTGTCTTCAAACCTCTACGAACTGATCAAGCAAAATCAATTCCAGGGCCTGAG
CACCCAGCTTGTTAAAGTCTTCATGGCGCAGTTATTGGATGCCTTGACCGTACTCAAAGACGCTCGGCTCATTCA
CTGCGATCTCAAACCAGAAAATATTCTCCTAAAATCGCGAGTCTCTTTTTTTCCGCTGCTCAATCCCTTGACTGA
TATCCATCGGCAGATTGCAGTCACCTCAAATAAAAATCATTGATTTTGGTTCTGCGTGCCACGAGCGACAGACTG
TCTATACATACATTCAATCTCGGTTCTATCGGTCACCAGAGGTGCTGTTAGGGATGTCGTATACGGCCTCCATTG
ACATGTGGTCATTGGGCTGCATTGCTGTTGAACTATTCCTTGGGCTTCCGTTGTTTCCGGGAACAAGCGAGTATA
ACCAATTGACTAGAATCATTGAAATGCTTGGGTGAGTGTAATTTCGATCCATCTTGTTTTGGGTACTCAAGTCAA
ATCGCCAGTATGCCGCCGCTGAGTATGTTGAACACTGGCAAACAAGTCGGTCAGTTTTTCGACTCTTACGAGGTT
TGGAATGCACATACAAGTCAAAACGAACGGAAATACAAAATGAAGTCCATGGAGCAATATTCCAGGGAACACGGG
ACTAATGAACAACCTGGGAAACAGTATTTCAAGGCAACGACGCTGCAGGATATCATTAATACGGCTCCCATACCC
CAAGTCAAATCGTCGAGATGTTCGGGCAACGAGGTGGAGAAAGAAATGGCGAATCGCGCCGCATTCATCGACTTT
TGCCAAGGTCTTCTGAACCTCAACCCAGTTACACGCTGGACTCCTCAACAGGCGAGGATGCACCCCTTCATCACG
GGAGAAAAATTCACAAAGCCATTCGTCGTATGTCACCTCGCTGTCTCGTATCGCTATTACTAACTACCAAAAGCC
TGACAACCCAATTATGGTCTCACATATGTCGCCGTCAATCTCCGATTCGAAGAGACCGTATGGTGGCTTGGTGCC
TCCCGCACCAAAAGGGCAGAGACCCATCTTTGATGCCGCGGCTTATAATCACCAACTGGCTCAACATCAAGCTTA
TACGGCGCAGGTCGCGAGTCAAGCTGCAAATGTCACACGGAACCCTTATATAGTCACTCATCCTCCCCAACAAGC
ATCAGGTCAAGCCCCTCCGTCGTATCAAAATTCACCGGACGCCAACGTCGTTCCTTATCAACCACAACAACACCA
CTCCCATGCGCATGCTCAGTACGCAGGACAAAATGCTAGTAGGGGACTTTCTCATCAAAGTTCAGCTGGGCAACT
GGCGAGTAATGCTGGTTCTGCACCTGGCCCTGCTGCTGGCCCTTATGCTGCTGGCGGAGGTGCCAATCAGCCACA
CATCAAACCTTCCTCTGGATCTGGCGGTGCCCCTGCTTCCGCAACTTATTATCCTAATTCACGTGCTCGAGCCAA
CACAATTAACCAGATGGATACTGTGCCTCCCGCATTGGCCCGGTTGCAGCATATGAATCAAGACGTCATCGGCGG
AAGGAACGCGTTGACACCTGTTTTGAACCGGGATGATGCTCTGAAAGAGTGGGAGAGGAGGCAACAAGGAGGACA
ACCTGCGCAGGTGCAACCGTATCCACAATTGGAGTATTTGCAGCAACAAGCTGAGATGGCTTCTGCTGGCGGTTT
AAGTGGATGGGGTGCTAATGTGGCTGCTGCTGCTTTGGGCATGCACCCTCATGCACATAATCATCGGTATCCCCC
TCCTCCCAGTAAACTCTCTCAATCTTATCATCCACAAACGCTGCTAGTCGACGATGACAGGCGGGAAGCAATCAT
GTCAAATGTGAGGGCTATAGCAAGAGGGGATAATCCAGGTCAACAAGGACAACAGCAACAATCGATTGGGGGGGC
ACAGCAAGTACCTCCGCCTCCACCACAAAGTGGAGGGTTGTACGGTTCTGCTGGTGGAGGTGCGGCTTTTTCTGC
CAATACGATTGCAAGTCCTCCGCAGACTTACGGTGGTAATATGGCTGTTACAGGAAATCGATATGCGGCGGCGTA
TGGTGGCCCACAAGCACCTCCACCTCAATCACAACAACAGCAGCAACAACAGCAACAACAACAGCAACAACAACA
TCAGGTCAACGGGGGGAATGGAACTGGTGTACCTTCGTTTGATTCGATTGATAGAAGGGGTGATATGGGGAGCAT
GTATGTCCCTATGCAACCGGACAATTATCATCAGCAACATCATCAACATCAGTATGCTGGTTCTGGCAATTCCGC
ACCTCAAGCTACTCCTCGGCATATGGTTGCCCCGCCTCAACAAGCGGCAGCACCTTCGTTCTATGGGGCTGGAAT
TGTACCAAGTGGCGTCGCACAACCGCATTCACAGCAAGGACAGCCAGGACAAGTGCAACAGGGACAGCAAGGACA
TCAACAGAGGAACCCGTTTACGTCGATGCAGATGCCAGATAATGGGGTTGGAATGGGAGGAATTGGAAAACCTGA
TGTACGGAGAGGTAATGGGATGGATGCCTGGCCCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail