Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042480
Gene name
Locationscaffold_2:1003070..1003859
Strand-
Gene length (bp)789
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 1.3E-06 101 125
PF12874 zf-met Zinc-finger of C2H2 type 2.1E-05 101 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CPW7|ZMAT2_MOUSE Zinc finger matrin-type protein 2 OS=Mus musculus GN=Zmat2 PE=2 SV=1 7 224 9.0E-36
sp|Q96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 OS=Homo sapiens GN=ZMAT2 PE=1 SV=1 7 224 9.0E-36
sp|P34670|YO14_CAEEL Putative zinc finger protein ZK686.4 OS=Caenorhabditis elegans GN=ZK686.4 PE=4 SV=1 6 224 3.0E-22
sp|Q09776|SNU23_SCHPO U4/U6.U5 small nuclear ribonucleoprotein component snu23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu23 PE=3 SV=4 68 222 5.0E-18
sp|Q12368|SNU23_YEAST 23 kDa U4/U6.U5 small nuclear ribonucleoprotein component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU23 PE=1 SV=1 18 224 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042480
MADKGGAYTSKASDTDFRKKWDKDEYAERAKQKDAEEKERMQENEERVKQGKRPRKGPKKDLPKPTELMKARDAP
LELDKNLGKTMVVQNPGGRGPGQPGFYCESCNRTYKDSVGYLDHINSRAHLRALGQSTKIERSTVEQVRARIAML
RERTKEASNAKAFDFDKRLAEIKSRELALRQEKKEQKKAEKEKARLELMKDLTSNADDEMAKMMGFGGFGSSKK*
Coding >AgabiH97|042480
ATGGCAGACAAAGGTGGTGCATATACTAGCAAAGCTTCGGACACCGACTTTCGCAAGAAATGGGACAAGGATGAG
TACGCAGAACGCGCGAAGCAGAAAGACGCAGAGGAGAAGGAGCGCATGCAAGAAAATGAGGAACGTGTGAAGCAA
GGAAAGCGACCCAGGAAAGGTCCCAAGAAAGACCTCCCGAAGCCTACTGAGTTAATGAAAGCTCGGGATGCACCA
CTCGAACTGGACAAAAATTTAGGAAAGACGATGGTAGTTCAAAACCCGGGCGGTAGAGGCCCGGGGCAACCAGGC
TTTTACTGTGAATCTTGCAACAGGACGTATAAAGACAGCGTTGGCTATCTCGACCACATCAACTCCAGAGCGCAT
CTACGAGCACTGGGCCAATCTACCAAAATAGAGCGGTCTACGGTGGAACAAGTTCGCGCTCGAATAGCAATGCTA
CGGGAAAGGACAAAGGAGGCGTCCAATGCCAAAGCTTTTGACTTCGACAAACGGTTGGCTGAGATCAAGTCCAGA
GAACTGGCTCTCCGGCAGGAGAAGAAAGAACAAAAGAAAGCAGAGAAGGAGAAAGCTCGCCTAGAACTCATGAAA
GACCTTACATCGAATGCTGATGATGAAATGGCCAAAATGATGGGTTTTGGTGGTTTTGGCTCTTCAAAGAAGTAG
Transcript >AgabiH97|042480
ATGGCAGACAAAGGTGGTGCATATACTAGCAAAGCTTCGGACACCGACTTTCGCAAGAAATGGGACAAGGATGAG
TACGCAGAACGCGCGAAGCAGAAAGACGCAGAGGAGAAGGAGCGCATGCAAGAAAATGAGGAACGTGTGAAGCAA
GGAAAGCGACCCAGGAAAGGTCCCAAGAAAGACCTCCCGAAGCCTACTGAGTTAATGAAAGCTCGGGATGCACCA
CTCGAACTGGACAAAAATTTAGGAAAGACGATGGTAGTTCAAAACCCGGGCGGTAGAGGCCCGGGGCAACCAGGC
TTTTACTGTGAATCTTGCAACAGGACGTATAAAGACAGCGTTGGCTATCTCGACCACATCAACTCCAGAGCGCAT
CTACGAGCACTGGGCCAATCTACCAAAATAGAGCGGTCTACGGTGGAACAAGTTCGCGCTCGAATAGCAATGCTA
CGGGAAAGGACAAAGGAGGCGTCCAATGCCAAAGCTTTTGACTTCGACAAACGGTTGGCTGAGATCAAGTCCAGA
GAACTGGCTCTCCGGCAGGAGAAGAAAGAACAAAAGAAAGCAGAGAAGGAGAAAGCTCGCCTAGAACTCATGAAA
GACCTTACATCGAATGCTGATGATGAAATGGCCAAAATGATGGGTTTTGGTGGTTTTGGCTCTTCAAAGAAGTAG
Gene >AgabiH97|042480
ATGGCAGACAAAGGTGGTGCATATACTAGCAAAGCTTCGGACACCGACTTTCGCAAGAAATGGGACAAGGATGAG
TACGCAGAACGCGCGAAGCAGAAAGACGCAGAGGAGAAGGAGCGCATGCAAGAAAATGAGGAACGTGTGAAGCAA
GGTCAGTAAACACGCACTTACTATGCATTCCAACTTCCTAATATCGCTGCTCAGGAAAGCGACCCAGGAAAGGTC
CCAAGAAAGACCTCCCGAAGCCTACTGAGTTAATGAAAGCTCGGGATGCACCACTCGAACTGGACAAAAATTTAG
GAAAGACGATGGTAGTTCAAAACCCGGGCGGTAGAGGCCCGGGGCAACCAGGCTTTTACTGTGAATCTTGCAACA
GGACGTATAAAGACAGCGTTGGCTATCTCGACCACATCAACTCCAGAGCGCGTACGCCTTTAAATCCCTTTTTCT
ATATGTGAAAAATATTGACACTAACATTGGGCAACAGATCTACGAGCACTGGGCCAATCTACCAAAATAGAGCGG
TCTACGGTGGAACAAGTTCGCGCTCGAATAGCAATGCTACGGGAAAGGACAAAGGAGGCGTCCAATGCCAAAGCT
TTTGACTTCGACAAACGGTTGGCTGAGATCAAGTCCAGAGAACTGGCTCTCCGGCAGGAGAAGAAAGAACAAAAG
AAAGCAGAGAAGGAGAAAGCTCGCCTAGAACTCATGAAAGACCTTACATCGAATGCTGATGATGAAATGGCCAAA
ATGATGGGTTTTGGTGGTTTTGGCTCTTCAAAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail