© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|042450 |
| Gene name | |
| Location | scaffold_2:995369..996052 |
| Strand | + |
| Gene length (bp) | 683 |
| Transcript length (bp) | 471 |
| Coding sequence length (bp) | 471 |
| Protein length (aa) | 157 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04699 | P16-Arc | ARP2/3 complex 16 kDa subunit (p16-Arc) | 6.5E-53 | 4 | 156 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40518|ARPC5_YEAST | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 | 1 | 156 | 2.0E-24 |
| sp|Q9CPW4|ARPC5_MOUSE | Actin-related protein 2/3 complex subunit 5 OS=Mus musculus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 4.0E-24 |
| sp|Q4KLF8|ARPC5_RAT | Actin-related protein 2/3 complex subunit 5 OS=Rattus norvegicus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q5R516|ARPC5_PONAB | Actin-related protein 2/3 complex subunit 5 OS=Pongo abelii GN=ARPC5 PE=2 SV=3 | 5 | 156 | 1.0E-23 |
| sp|O15511|ARPC5_HUMAN | Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens GN=ARPC5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40518|ARPC5_YEAST | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 | 1 | 156 | 2.0E-24 |
| sp|Q9CPW4|ARPC5_MOUSE | Actin-related protein 2/3 complex subunit 5 OS=Mus musculus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 4.0E-24 |
| sp|Q4KLF8|ARPC5_RAT | Actin-related protein 2/3 complex subunit 5 OS=Rattus norvegicus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q5R516|ARPC5_PONAB | Actin-related protein 2/3 complex subunit 5 OS=Pongo abelii GN=ARPC5 PE=2 SV=3 | 5 | 156 | 1.0E-23 |
| sp|O15511|ARPC5_HUMAN | Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens GN=ARPC5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q3SYX9|ARPC5_BOVIN | Actin-related protein 2/3 complex subunit 5 OS=Bos taurus GN=ARPC5 PE=1 SV=3 | 5 | 156 | 3.0E-23 |
| sp|A1L108|ARP5L_RAT | Actin-related protein 2/3 complex subunit 5-like protein OS=Rattus norvegicus GN=Arpc5l PE=1 SV=2 | 1 | 156 | 5.0E-21 |
| sp|Q10316|ARPC5_SCHPO | Actin-related protein 2/3 complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc5 PE=1 SV=1 | 4 | 153 | 8.0E-21 |
| sp|Q5E963|ARP5L_BOVIN | Actin-related protein 2/3 complex subunit 5-like protein OS=Bos taurus GN=ARPC5L PE=2 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q9D898|ARP5L_MOUSE | Actin-related protein 2/3 complex subunit 5-like protein OS=Mus musculus GN=Arpc5l PE=1 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q5R4M1|ARP5L_PONAB | Actin-related protein 2/3 complex subunit 5-like protein OS=Pongo abelii GN=ARPC5L PE=2 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q9BPX5|ARP5L_HUMAN | Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens GN=ARPC5L PE=1 SV=1 | 1 | 156 | 3.0E-20 |
| sp|P91167|ARPC5_CAEEL | Probable actin-related protein 2/3 complex subunit 5 OS=Caenorhabditis elegans GN=C46H11.3 PE=3 SV=1 | 45 | 154 | 2.0E-14 |
| sp|O96626|ARPC5_DICDI | Actin-related protein 2/3 complex subunit 5 OS=Dictyostelium discoideum GN=arcE PE=1 SV=1 | 40 | 156 | 5.0E-11 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0034314 | Arp2/3 complex-mediated actin nucleation | Yes |
| GO:0030833 | regulation of actin filament polymerization | Yes |
| GO:0015629 | actin cytoskeleton | Yes |
| GO:0005885 | Arp2/3 protein complex | Yes |
| GO:0008150 | biological_process | No |
| GO:0110053 | regulation of actin filament organization | No |
| GO:0044087 | regulation of cellular component biogenesis | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0005856 | cytoskeleton | No |
| GO:0043254 | regulation of protein-containing complex assembly | No |
| GO:0007015 | actin filament organization | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0005575 | cellular_component | No |
| GO:0032956 | regulation of actin cytoskeleton organization | No |
| GO:0065007 | biological regulation | No |
| GO:0090066 | regulation of anatomical structure size | No |
| GO:0032970 | regulation of actin filament-based process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0051493 | regulation of cytoskeleton organization | No |
| GO:0030832 | regulation of actin filament length | No |
| GO:0033043 | regulation of organelle organization | No |
| GO:0032535 | regulation of cellular component size | No |
| GO:0065008 | regulation of biological quality | No |
| GO:0016043 | cellular component organization | No |
| GO:0050789 | regulation of biological process | No |
| GO:0009987 | cellular process | No |
| GO:0008064 | regulation of actin polymerization or depolymerization | No |
| GO:0045010 | actin nucleation | No |
| GO:0032991 | protein-containing complex | No |
| GO:1902903 | regulation of supramolecular fiber organization | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0043226 | organelle | No |
| GO:0032271 | regulation of protein polymerization | No |
| GO:0097435 | supramolecular fiber organization | No |
| GO:0051128 | regulation of cellular component organization | No |
| GO:0043229 | intracellular organelle | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 42 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 312.87 | 179.66 | 446.09 |
| Initials | Initials knots | 323.90 | 194.29 | 453.50 |
| Pileal_Stipeal_center | Stage I stipe center | 119.24 | 66.19 | 172.28 |
| Pileal_Stipeal_shell | Stage I stipe shell | 119.28 | 65.99 | 172.57 |
| DIF_stipe_center | Stage II stipe center | 92.06 | 49.83 | 134.29 |
| DIF_stipe_shell | Stage II stipe shell | 105.62 | 58.06 | 153.17 |
| DIF_stipe_skin | Stage II stipe skin | 144.58 | 81.34 | 207.82 |
| DIF_cap_skin | Stage II cap skin | 113.47 | 62.90 | 164.03 |
| DIF_cap_tissue | Stage II cap tissue | 67.82 | 35.27 | 100.37 |
| DIF_gill_tissue | Stage II gill tissue | 64.00 | 31.79 | 96.20 |
| YFB_stipe_center | Young fruiting body stipe center | 207.87 | 121.34 | 294.40 |
| YFB_stipe_shell | Young fruiting body stipe shell | 168.29 | 97.60 | 238.97 |
| YFB_stipe_skin | Young fruiting body stipe skin | 148.81 | 84.13 | 213.50 |
| YFB_cap_skin | Young fruiting body cap skin | 195.41 | 114.22 | 276.59 |
| YFB_cap_tissue | Young fruiting body cap tissue | 45.85 | 22.62 | 69.07 |
| YFB_gill_tissue | Young fruiting body gill tissue | 198.27 | 109.67 | 286.87 |
| YFB_veil | Young fruiting body veil | 134.12 | 75.79 | 192.46 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.183056 | no |
| Casing | YFB_stipe_shell | 0.022892 | yes |
| Casing | YFB_stipe_skin | 0.005302 | yes |
| Casing | YFB_cap_skin | 0.114428 | no |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.140982 | no |
| Casing | YFB_veil | 0.001140 | yes |
| Casing | Initials | 0.949271 | no |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.003365 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.001625 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.005302 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.422501 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.019169 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.581181 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.306815 | no |
| YFB_stipe_center | YFB_cap_skin | 0.908261 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.935051 | no |
| YFB_stipe_center | YFB_veil | 0.146589 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.792214 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.733169 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.705536 | no |
| YFB_stipe_shell | YFB_veil | 0.551460 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.452682 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.430255 | no |
| YFB_stipe_skin | YFB_veil | 0.837146 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.980942 | no |
| YFB_cap_skin | YFB_veil | 0.237553 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.231862 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.117779 | no |
| Initials | YFB_stipe_shell | 0.010412 | yes |
| Initials | YFB_stipe_skin | 0.001625 | yes |
| Initials | YFB_cap_skin | 0.066584 | no |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.088950 | no |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.001625 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.050908 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.056367 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.301356 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.582651 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.102511 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.001625 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.098276 | no |
| Pileal_Stipeal_center | YFB_veil | 0.812469 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.999257 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.514744 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.807212 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.656991 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.933372 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.068640 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.049467 | yes |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.055381 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.299170 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.585450 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.099434 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.001625 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.095478 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.812167 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.514191 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.806029 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.656189 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.932573 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.067147 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.332623 | no |
| DIF_stipe_center | YFB_stipe_center | 0.003765 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.035076 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.131698 | no |
| DIF_stipe_center | YFB_cap_skin | 0.005671 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.023153 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.006032 | yes |
| DIF_stipe_center | YFB_veil | 0.267567 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.778766 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.168405 | no |
| DIF_stipe_center | DIF_cap_skin | 0.624033 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.423834 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.133144 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.011968 | yes |
| DIF_stipe_shell | YFB_stipe_shell | 0.119313 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.316421 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.033674 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.004928 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.027451 | yes |
| DIF_stipe_shell | YFB_veil | 0.544970 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.381187 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.899804 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.179329 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.005671 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.265551 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.735958 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.961456 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.396194 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.376873 | no |
| DIF_stipe_skin | YFB_veil | 0.890065 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.543883 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.007092 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.081238 | no |
| DIF_cap_skin | YFB_stipe_center | 0.032266 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.217423 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.474469 | no |
| DIF_cap_skin | YFB_cap_skin | 0.068081 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.002525 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.062807 | no |
| DIF_cap_skin | YFB_veil | 0.707700 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.106969 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.928122 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.001625 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.004548 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.290957 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_veil | 0.017226 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|042450 METSFRKIDIDKYDEDVLNDEDLYDADPRDPAMVLEEAKQRQVAVRSSLAKNDTAGALAVILDSPPYGPNTEQAK EITLSTLLTILNSTKTTEITPVIKSLSQDAQDTLMKYIYKGMAMPGWGDISGSVLLGWHEKLTEVTGVGSIVRAM TDRRIV* |
| Coding | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCCAAA GAAATCACATTGTCTACACTTCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCT TTATCTCAAGATGCTCAAGATACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATT AGTGGGAGTGTTTTACTTGGCTGGCATGAGAAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATG ACAGATCGTAGAATTGTATAA |
| Transcript | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCCAAA GAAATCACATTGTCTACACTTCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCT TTATCTCAAGATGCTCAAGATACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATT AGTGGGAGTGTTTTACTTGGCTGGCATGAGAAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATG ACAGATCGTAGAATTGTATAA |
| Gene | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGTGGGTCTTCTTATGACTTACAGCTATTTGTTTGACTTCCCAATGTAACGCATGATATTGAAACATTCTTCCC ATTAGGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCC AAAGTACGTATCTTTCCAATTCTACGAACGATCGCTATAATTTTGATGGAAAAAGGAAATCACATTGTCTACACT TCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCTTTATCTCAAGATGCTCAAGA TACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATTAGTGGGAGTGTTTTACTTGG CTGGCATGAGAAGGTGCGTTTCGGGTGTATATATTTCAATGATCTAAAAACTAAATATTGAACACACCTTTCGCG ATTCTTCTTTGTTTTTGCAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATGACAGATCGTAGAA TTGTATAA |