© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|042450 |
| Gene name | |
| Location | scaffold_2:995369..996052 |
| Strand | + |
| Gene length (bp) | 683 |
| Transcript length (bp) | 471 |
| Coding sequence length (bp) | 471 |
| Protein length (aa) | 157 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF04699 | P16-Arc | ARP2/3 complex 16 kDa subunit (p16-Arc) | 6.5E-53 | 4 | 156 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40518|ARPC5_YEAST | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 | 1 | 156 | 2.0E-24 |
| sp|Q9CPW4|ARPC5_MOUSE | Actin-related protein 2/3 complex subunit 5 OS=Mus musculus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 4.0E-24 |
| sp|Q4KLF8|ARPC5_RAT | Actin-related protein 2/3 complex subunit 5 OS=Rattus norvegicus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q5R516|ARPC5_PONAB | Actin-related protein 2/3 complex subunit 5 OS=Pongo abelii GN=ARPC5 PE=2 SV=3 | 5 | 156 | 1.0E-23 |
| sp|O15511|ARPC5_HUMAN | Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens GN=ARPC5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40518|ARPC5_YEAST | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 | 1 | 156 | 2.0E-24 |
| sp|Q9CPW4|ARPC5_MOUSE | Actin-related protein 2/3 complex subunit 5 OS=Mus musculus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 4.0E-24 |
| sp|Q4KLF8|ARPC5_RAT | Actin-related protein 2/3 complex subunit 5 OS=Rattus norvegicus GN=Arpc5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q5R516|ARPC5_PONAB | Actin-related protein 2/3 complex subunit 5 OS=Pongo abelii GN=ARPC5 PE=2 SV=3 | 5 | 156 | 1.0E-23 |
| sp|O15511|ARPC5_HUMAN | Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens GN=ARPC5 PE=1 SV=3 | 5 | 156 | 1.0E-23 |
| sp|Q3SYX9|ARPC5_BOVIN | Actin-related protein 2/3 complex subunit 5 OS=Bos taurus GN=ARPC5 PE=1 SV=3 | 5 | 156 | 3.0E-23 |
| sp|A1L108|ARP5L_RAT | Actin-related protein 2/3 complex subunit 5-like protein OS=Rattus norvegicus GN=Arpc5l PE=1 SV=2 | 1 | 156 | 5.0E-21 |
| sp|Q10316|ARPC5_SCHPO | Actin-related protein 2/3 complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc5 PE=1 SV=1 | 4 | 153 | 8.0E-21 |
| sp|Q5E963|ARP5L_BOVIN | Actin-related protein 2/3 complex subunit 5-like protein OS=Bos taurus GN=ARPC5L PE=2 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q9D898|ARP5L_MOUSE | Actin-related protein 2/3 complex subunit 5-like protein OS=Mus musculus GN=Arpc5l PE=1 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q5R4M1|ARP5L_PONAB | Actin-related protein 2/3 complex subunit 5-like protein OS=Pongo abelii GN=ARPC5L PE=2 SV=1 | 1 | 156 | 3.0E-20 |
| sp|Q9BPX5|ARP5L_HUMAN | Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens GN=ARPC5L PE=1 SV=1 | 1 | 156 | 3.0E-20 |
| sp|P91167|ARPC5_CAEEL | Probable actin-related protein 2/3 complex subunit 5 OS=Caenorhabditis elegans GN=C46H11.3 PE=3 SV=1 | 45 | 154 | 2.0E-14 |
| sp|O96626|ARPC5_DICDI | Actin-related protein 2/3 complex subunit 5 OS=Dictyostelium discoideum GN=arcE PE=1 SV=1 | 40 | 156 | 5.0E-11 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0034314 | Arp2/3 complex-mediated actin nucleation | Yes |
| GO:0030833 | regulation of actin filament polymerization | Yes |
| GO:0015629 | actin cytoskeleton | Yes |
| GO:0005885 | Arp2/3 protein complex | Yes |
| GO:0008150 | biological_process | No |
| GO:0110053 | regulation of actin filament organization | No |
| GO:0044087 | regulation of cellular component biogenesis | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0005856 | cytoskeleton | No |
| GO:0043254 | regulation of protein-containing complex assembly | No |
| GO:0007015 | actin filament organization | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0005575 | cellular_component | No |
| GO:0032956 | regulation of actin cytoskeleton organization | No |
| GO:0065007 | biological regulation | No |
| GO:0090066 | regulation of anatomical structure size | No |
| GO:0032970 | regulation of actin filament-based process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0051493 | regulation of cytoskeleton organization | No |
| GO:0030832 | regulation of actin filament length | No |
| GO:0033043 | regulation of organelle organization | No |
| GO:0032535 | regulation of cellular component size | No |
| GO:0065008 | regulation of biological quality | No |
| GO:0016043 | cellular component organization | No |
| GO:0050789 | regulation of biological process | No |
| GO:0009987 | cellular process | No |
| GO:0008064 | regulation of actin polymerization or depolymerization | No |
| GO:0045010 | actin nucleation | No |
| GO:0032991 | protein-containing complex | No |
| GO:1902903 | regulation of supramolecular fiber organization | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0050794 | regulation of cellular process | No |
| GO:0043226 | organelle | No |
| GO:0032271 | regulation of protein polymerization | No |
| GO:0097435 | supramolecular fiber organization | No |
| GO:0051128 | regulation of cellular component organization | No |
| GO:0043229 | intracellular organelle | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 42 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|042450 METSFRKIDIDKYDEDVLNDEDLYDADPRDPAMVLEEAKQRQVAVRSSLAKNDTAGALAVILDSPPYGPNTEQAK EITLSTLLTILNSTKTTEITPVIKSLSQDAQDTLMKYIYKGMAMPGWGDISGSVLLGWHEKLTEVTGVGSIVRAM TDRRIV* |
| Coding | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCCAAA GAAATCACATTGTCTACACTTCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCT TTATCTCAAGATGCTCAAGATACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATT AGTGGGAGTGTTTTACTTGGCTGGCATGAGAAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATG ACAGATCGTAGAATTGTATAA |
| Transcript | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCCAAA GAAATCACATTGTCTACACTTCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCT TTATCTCAAGATGCTCAAGATACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATT AGTGGGAGTGTTTTACTTGGCTGGCATGAGAAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATG ACAGATCGTAGAATTGTATAA |
| Gene | >AgabiH97|042450 ATGGAGACCTCATTCCGTAAAATTGATATTGACAAATACGATGAGGATGTCTTGAATGATGAAGATCTCTACGAT GCTGATCCAAGAGATCCTGCCATGGTTTTAGAAGAGGCTAAGCAGAGACAAGTGGCCGTCAGGAGTTCATTGGCA AAGTGGGTCTTCTTATGACTTACAGCTATTTGTTTGACTTCCCAATGTAACGCATGATATTGAAACATTCTTCCC ATTAGGAACGACACAGCCGGTGCTCTAGCCGTGATTCTAGACAGCCCTCCTTATGGTCCAAACACAGAACAAGCC AAAGTACGTATCTTTCCAATTCTACGAACGATCGCTATAATTTTGATGGAAAAAGGAAATCACATTGTCTACACT TCTAACCATCCTCAATTCGACGAAAACGACCGAAATCACACCAGTGATCAAGTCTTTATCTCAAGATGCTCAAGA TACATTGATGAAATATATCTATAAGGGTATGGCGATGCCTGGATGGGGTGATATTAGTGGGAGTGTTTTACTTGG CTGGCATGAGAAGGTGCGTTTCGGGTGTATATATTTCAATGATCTAAAAACTAAATATTGAACACACCTTTCGCG ATTCTTCTTTGTTTTTGCAGCTTACTGAGGTCACCGGAGTTGGTAGTATTGTGCGTGCAATGACAGATCGTAGAA TTGTATAA |