Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042440
Gene name
Locationscaffold_2:994341..995069
Strand+
Gene length (bp)728
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A3PXS9|Y1918_MYCSJ Uncharacterized oxidoreductase Mjls_1918 OS=Mycobacterium sp. (strain JLS) GN=Mjls_1918 PE=3 SV=1 41 124 4.0E-06
sp|A1UEC5|Y1984_MYCSK Uncharacterized oxidoreductase Mkms_1984 OS=Mycobacterium sp. (strain KMS) GN=Mkms_1984 PE=3 SV=1 41 124 6.0E-06
sp|Q1BAN7|Y1938_MYCSS Uncharacterized oxidoreductase Mmcs_1938 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_1938 PE=3 SV=1 41 124 6.0E-06
sp|Q8ZI40|DKGA_YERPE 2,5-diketo-D-gluconic acid reductase A OS=Yersinia pestis GN=dkgA PE=3 SV=1 73 124 1.0E-05

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042440
MDLVLGGSWIYVRVSASRVLLLVLSKWASTNRSPCWVLTTSILKLFGVTNYGVKHLEEIRQAGYPLPVVNQIEYN
KQLAQVLVRWSLQKGPLLKSDTPACIRSNNNVPDFILTDEEIATADKLD*
Coding >AgabiH97|042440
ATGGATTTGGTTCTTGGGGGCAGCTGGATATACGTCCGTGTATCTGCAAGTCGGGTATTGTTATTGGTTTTGTCA
AAGTGGGCATCGACGAATCGCTCGCCATGTTGGGTTTTGACTACCTCGATATTGAAACTCTTCGGTGTCACCAAC
TATGGCGTGAAGCATCTGGAAGAGATCAGGCAGGCAGGTTACCCTCTACCTGTCGTTAATCAAATCGAATATAAC
AAACAGCTTGCTCAAGTCCTCGTCAGGTGGTCGCTTCAAAAAGGACCGCTATTGAAGAGTGATACACCCGCATGC
ATCCGCTCTAATAATAATGTCCCTGACTTTATATTGACCGATGAAGAGATCGCTACTGCTGATAAATTGGACTAG
Transcript >AgabiH97|042440
ATGGATTTGGTTCTTGGGGGCAGCTGGATATACGTCCGTGTATCTGCAAGTCGGGTATTGTTATTGGTTTTGTCA
AAGTGGGCATCGACGAATCGCTCGCCATGTTGGGTTTTGACTACCTCGATATTGAAACTCTTCGGTGTCACCAAC
TATGGCGTGAAGCATCTGGAAGAGATCAGGCAGGCAGGTTACCCTCTACCTGTCGTTAATCAAATCGAATATAAC
AAACAGCTTGCTCAAGTCCTCGTCAGGTGGTCGCTTCAAAAAGGACCGCTATTGAAGAGTGATACACCCGCATGC
ATCCGCTCTAATAATAATGTCCCTGACTTTATATTGACCGATGAAGAGATCGCTACTGCTGATAAATTGGACTAG
Gene >AgabiH97|042440
ATGGATTTGGTTCTTGGGGGCAGCTGGATATACGTCCGTGTATCTGCAAGTCGGGTATTGTTATTGGTTTTGTCA
AAGTGGTACTGCTATTCGTGAACAATCGGCTTGGTGTTTGAAGCTTCGGTGACCAAGGGCATCGACGAATCGCTC
GCCATGTTGGGTTTTGGTTAGTGCTTTATCCTGTCGAAACGCACCGATTAATTAACAAGATGATTCATAGACTAC
CTCGATATGTTCCTTATCCACGATTCCCTGTCTAAGACAAACGTCTTGAGTCGTACAAAGCATAGAAGGCCATCA
AAGTGAAACTCTTCGGTGTCACCAACTAGTAAGCGACAAACGCCCACATCTCATAACCTTTTAATTAATACCTTT
CTTTTTTTTTCAAAGTGGCGTGAAGCATCTGGAAGAGATCAGGCAGGCAGGTTACCCTCTACCTGTCGTTAATCA
AATCGAAGTAAGCCATCTCTCCAGAGATGCACTTTCATTTCTGATTGTTTCTTCCGGTGTCATACTAGTATAACA
AACAGCTTGCTCAAGTCCTCGTCAGGTGGTCGCTTCAAAAAGGGTGCCTGTGTGTATTCATTATCCTGAGCTCAT
AGTTCAAGAAAAACCGATGCAGACCGCTATTGAAGAGTGATACACCCGCATGCATCCGCTCTAATAATAATGTCC
CTGACTTTATATTGACCGATGAAGAGATCGCTACTGCTGATAAATTGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail