Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042430
Gene name
Locationscaffold_2:991616..992985
Strand-
Gene length (bp)1369
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 32.63 18.59 46.67
Initials Initials knots 54.58 32.11 77.05
Pileal_Stipeal_center Stage I stipe center 59.57 35.81 83.33
Pileal_Stipeal_shell Stage I stipe shell 48.98 29.00 68.97
DIF_stipe_center Stage II stipe center 81.22 48.86 113.58
DIF_stipe_shell Stage II stipe shell 89.57 54.27 124.88
DIF_stipe_skin Stage II stipe skin 75.52 45.49 105.56
DIF_cap_skin Stage II cap skin 36.23 20.84 51.62
DIF_cap_tissue Stage II cap tissue 43.31 25.25 61.37
DIF_gill_tissue Stage II gill tissue 49.15 28.88 69.41
YFB_stipe_center Young fruiting body stipe center 99.89 60.89 138.89
YFB_stipe_shell Young fruiting body stipe shell 112.45 68.24 156.66
YFB_stipe_skin Young fruiting body stipe skin 86.46 52.38 120.55
YFB_cap_skin Young fruiting body cap skin 32.37 18.26 46.48
YFB_cap_tissue Young fruiting body cap tissue 32.03 17.48 46.57
YFB_gill_tissue Young fruiting body gill tissue 39.01 22.53 55.50
YFB_veil Young fruiting body veil 40.76 23.72 57.81

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.193760 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.988778 no
Casing YFB_cap_tissue 0.974310 no
Casing YFB_gill_tissue 0.675895 no
Casing YFB_veil 0.567159 no
Casing Initials 0.079123 no
Casing Pileal_Stipeal_center 0.029890 yes
Casing Pileal_Stipeal_shell 0.199497 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.836219 no
Casing DIF_cap_tissue 0.429326 no
DIF_gill_tissue YFB_stipe_center 0.006032 yes
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.034837 yes
DIF_gill_tissue YFB_cap_skin 0.178332 no
DIF_gill_tissue YFB_cap_tissue 0.170490 no
DIF_gill_tissue YFB_gill_tissue 0.541827 no
DIF_gill_tissue YFB_veil 0.638685 no
YFB_stipe_center YFB_stipe_shell 0.790147 no
YFB_stipe_center YFB_stipe_skin 0.727181 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.426697 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.002951 yes
YFB_stipe_skin YFB_veil 0.002525 yes
YFB_cap_skin YFB_cap_tissue 0.985568 no
YFB_cap_skin YFB_gill_tissue 0.655875 no
YFB_cap_skin YFB_veil 0.545593 no
YFB_cap_tissue YFB_gill_tissue 0.634330 no
YFB_cap_tissue YFB_veil 0.525771 no
YFB_gill_tissue YFB_veil 0.938138 no
Initials DIF_gill_tissue 0.831965 no
Initials YFB_stipe_center 0.017783 yes
Initials YFB_stipe_shell 0.003765 yes
Initials YFB_stipe_skin 0.099273 no
Initials YFB_cap_skin 0.070681 no
Initials YFB_cap_tissue 0.070499 no
Initials YFB_gill_tissue 0.310296 no
Initials YFB_veil 0.389072 no
Initials Pileal_Stipeal_center 0.858572 no
Initials Pileal_Stipeal_shell 0.820525 no
Initials DIF_stipe_center 0.179706 no
Initials DIF_stipe_shell 0.066584 no
Initials DIF_stipe_skin 0.305777 no
Initials DIF_cap_skin 0.185943 no
Initials DIF_cap_tissue 0.533750 no
Pileal_Stipeal_center DIF_gill_tissue 0.626027 no
Pileal_Stipeal_center YFB_stipe_center 0.053965 no
Pileal_Stipeal_center YFB_stipe_shell 0.015242 yes
Pileal_Stipeal_center YFB_stipe_skin 0.205647 no
Pileal_Stipeal_center YFB_cap_skin 0.026461 yes
Pileal_Stipeal_center YFB_cap_tissue 0.025711 yes
Pileal_Stipeal_center YFB_gill_tissue 0.160121 no
Pileal_Stipeal_center YFB_veil 0.204693 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.613191 no
Pileal_Stipeal_center DIF_stipe_center 0.330474 no
Pileal_Stipeal_center DIF_stipe_shell 0.151524 no
Pileal_Stipeal_center DIF_stipe_skin 0.496427 no
Pileal_Stipeal_center DIF_cap_skin 0.081927 no
Pileal_Stipeal_center DIF_cap_tissue 0.328878 no
Pileal_Stipeal_shell DIF_gill_tissue 0.994825 no
Pileal_Stipeal_shell YFB_stipe_center 0.005671 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.030610 yes
Pileal_Stipeal_shell YFB_cap_skin 0.181569 no
Pileal_Stipeal_shell YFB_cap_tissue 0.172307 no
Pileal_Stipeal_shell YFB_gill_tissue 0.544686 no
Pileal_Stipeal_shell YFB_veil 0.644890 no
Pileal_Stipeal_shell DIF_stipe_center 0.063376 no
Pileal_Stipeal_shell DIF_stipe_shell 0.020790 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.129827 no
Pileal_Stipeal_shell DIF_cap_skin 0.378147 no
Pileal_Stipeal_shell DIF_cap_tissue 0.786123 no
DIF_stipe_center DIF_gill_tissue 0.065833 no
DIF_stipe_center YFB_stipe_center 0.561721 no
DIF_stipe_center YFB_stipe_shell 0.289094 no
DIF_stipe_center YFB_stipe_skin 0.896775 no
DIF_stipe_center YFB_cap_skin 0.001625 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.005302 yes
DIF_stipe_center YFB_veil 0.006032 yes
DIF_stipe_center DIF_stipe_shell 0.828166 no
DIF_stipe_center DIF_stipe_skin 0.878652 no
DIF_stipe_center DIF_cap_skin 0.002084 yes
DIF_stipe_center DIF_cap_tissue 0.014956 yes
DIF_stipe_shell DIF_gill_tissue 0.020523 yes
DIF_stipe_shell YFB_stipe_center 0.807243 no
DIF_stipe_shell YFB_stipe_shell 0.518516 no
DIF_stipe_shell YFB_stipe_skin 0.945756 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.002084 yes
DIF_stipe_shell YFB_veil 0.002525 yes
DIF_stipe_shell DIF_stipe_skin 0.656751 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.004928 yes
DIF_stipe_skin DIF_gill_tissue 0.135445 no
DIF_stipe_skin YFB_stipe_center 0.380934 no
DIF_stipe_skin YFB_stipe_shell 0.161964 no
DIF_stipe_skin YFB_stipe_skin 0.747302 no
DIF_stipe_skin YFB_cap_skin 0.002084 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.011968 yes
DIF_stipe_skin YFB_veil 0.017226 yes
DIF_stipe_skin DIF_cap_skin 0.004160 yes
DIF_stipe_skin DIF_cap_tissue 0.034377 yes
DIF_cap_skin DIF_gill_tissue 0.372405 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.822132 no
DIF_cap_skin YFB_cap_tissue 0.801202 no
DIF_cap_skin YFB_gill_tissue 0.888941 no
DIF_cap_skin YFB_veil 0.802114 no
DIF_cap_skin DIF_cap_tissue 0.665936 no
DIF_cap_tissue DIF_gill_tissue 0.783326 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.004928 yes
DIF_cap_tissue YFB_cap_skin 0.408674 no
DIF_cap_tissue YFB_cap_tissue 0.386814 no
DIF_cap_tissue YFB_gill_tissue 0.827234 no
DIF_cap_tissue YFB_veil 0.907044 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042430
MLHYVLLIVHRCLRGISYLRILLFELWQLLAVHLRDECVYGQVECSETECDMIVVRGELEAHRKEKHGKDTKQES
VEATEPDQAQPSCPTPTTDKPQQKEVELLMEQNFLLRHRVEMLEGAMQVMKREMNAVKSALGPWYRMPTTRPTYS
ARARTSLRPEGEEVAAEITNGNTGPSLDAANSLGAGEGNTVQARATHTRRRSLPLSGEMMENGGDGIREGDPFAG
YFPTIGDFGGLLSHHGAFAQQQQQGGGPGGLQINPGAVTRVAPLDLGTTLIGTLEGLRESVVGVAAGIDSLGRRS
EIALANESLRLGEEVVSMRGAVHGLRMQIHAMMMERNAQITGREEGMGAGSSWMGGGMNFGGQNASGPRMYSYGG
PPPNITKL*
Coding >AgabiH97|042430
ATGCTCCATTATGTCCTATTGATCGTTCACCGTTGTCTGAGAGGGATCTCGTACCTTCGGATCCTATTATTCGAA
CTCTGGCAGCTGTTGGCTGTTCATCTCAGAGATGAATGTGTGTATGGACAAGTGGAATGTAGTGAGACAGAGTGT
GATATGATTGTTGTGAGGGGTGAGTTGGAGGCACATCGAAAGGAGAAACATGGTAAGGATACGAAACAAGAATCT
GTTGAAGCTACAGAACCAGATCAAGCACAACCTTCATGTCCAACGCCAACCACTGATAAGCCACAGCAGAAAGAA
GTGGAATTGCTAATGGAACAAAACTTTCTTTTGCGACATCGAGTGGAAATGCTTGAAGGTGCTATGCAGGTTATG
AAGAGGGAGATGAATGCTGTGAAGAGTGCGCTAGGCCCGTGGTACCGTATGCCTACAACACGCCCGACCTATTCC
GCCCGAGCTCGTACCTCGCTACGGCCAGAAGGGGAAGAAGTAGCAGCTGAAATTACAAATGGGAATACCGGCCCA
TCACTCGATGCGGCAAATTCTTTGGGCGCGGGCGAGGGCAATACTGTGCAGGCGAGGGCGACACACACGCGTAGA
CGATCATTGCCTTTGTCGGGAGAAATGATGGAGAATGGCGGGGATGGGATCCGTGAAGGTGATCCCTTTGCTGGA
TACTTTCCTACGATCGGGGACTTTGGTGGATTACTGTCGCATCATGGGGCCTTTGCGCAACAGCAGCAGCAGGGA
GGAGGACCTGGTGGGCTTCAAATTAACCCGGGGGCTGTGACTAGGGTGGCGCCTTTGGATTTGGGGACAACTCTG
ATTGGGACATTGGAGGGACTACGAGAAAGCGTGGTTGGAGTTGCTGCGGGAATAGACTCACTAGGAAGGAGAAGC
GAAATTGCGTTGGCTAATGAAAGCTTACGGTTGGGAGAAGAGGTAGTTTCTATGCGGGGGGCTGTTCATGGGTTG
AGGATGCAGATCCATGCGATGATGATGGAGAGAAATGCGCAGATTACGGGGAGAGAGGAGGGGATGGGTGCCGGA
AGCTCGTGGATGGGTGGGGGGATGAATTTTGGTGGACAGAATGCCTCTGGACCGAGGATGTATTCTTATGGAGGA
CCACCGCCGAACATCACAAAACTATAA
Transcript >AgabiH97|042430
ATGCTCCATTATGTCCTATTGATCGTTCACCGTTGTCTGAGAGGGATCTCGTACCTTCGGATCCTATTATTCGAA
CTCTGGCAGCTGTTGGCTGTTCATCTCAGAGATGAATGTGTGTATGGACAAGTGGAATGTAGTGAGACAGAGTGT
GATATGATTGTTGTGAGGGGTGAGTTGGAGGCACATCGAAAGGAGAAACATGGTAAGGATACGAAACAAGAATCT
GTTGAAGCTACAGAACCAGATCAAGCACAACCTTCATGTCCAACGCCAACCACTGATAAGCCACAGCAGAAAGAA
GTGGAATTGCTAATGGAACAAAACTTTCTTTTGCGACATCGAGTGGAAATGCTTGAAGGTGCTATGCAGGTTATG
AAGAGGGAGATGAATGCTGTGAAGAGTGCGCTAGGCCCGTGGTACCGTATGCCTACAACACGCCCGACCTATTCC
GCCCGAGCTCGTACCTCGCTACGGCCAGAAGGGGAAGAAGTAGCAGCTGAAATTACAAATGGGAATACCGGCCCA
TCACTCGATGCGGCAAATTCTTTGGGCGCGGGCGAGGGCAATACTGTGCAGGCGAGGGCGACACACACGCGTAGA
CGATCATTGCCTTTGTCGGGAGAAATGATGGAGAATGGCGGGGATGGGATCCGTGAAGGTGATCCCTTTGCTGGA
TACTTTCCTACGATCGGGGACTTTGGTGGATTACTGTCGCATCATGGGGCCTTTGCGCAACAGCAGCAGCAGGGA
GGAGGACCTGGTGGGCTTCAAATTAACCCGGGGGCTGTGACTAGGGTGGCGCCTTTGGATTTGGGGACAACTCTG
ATTGGGACATTGGAGGGACTACGAGAAAGCGTGGTTGGAGTTGCTGCGGGAATAGACTCACTAGGAAGGAGAAGC
GAAATTGCGTTGGCTAATGAAAGCTTACGGTTGGGAGAAGAGGTAGTTTCTATGCGGGGGGCTGTTCATGGGTTG
AGGATGCAGATCCATGCGATGATGATGGAGAGAAATGCGCAGATTACGGGGAGAGAGGAGGGGATGGGTGCCGGA
AGCTCGTGGATGGGTGGGGGGATGAATTTTGGTGGACAGAATGCCTCTGGACCGAGGATGTATTCTTATGGAGGA
CCACCGCCGAACATCACAAAACTATAA
Gene >AgabiH97|042430
ATGCTCCATTATGTCCTATTGATCGTTCACCGTTGTCTGAGAGGGATCTCGTACCTTCGGATCCTATTATTCGAA
CTGTAAGTGTTGTGTATATCCCAAGGTTTTATGATTTATGGGGTTTTCTGTAGCTGGTAGAAGAACTCGCGGTGG
AATGTGTGCATAAATCTTCGGGATGTGAATATGTTTGTCAAAGGCAGCTGTTGGCTGTTCATCTCAGAGATGAAT
GTGTGTATGGACAAGTGGAATGTAGTGAGACAGAGTGTGATATGATTGTTGTGAGGGGTGAGTTGGAGGCACATC
GAAAGGAGAAACATGGTAAGGATACGAAACAAGAATCTGTGCGGGGTTACATTTGATTTTATTCATCGAGTTTAC
TCATGACATGGGTTTAGGTTGAAGCTACAGAACCAGATCAAGCACAACCTTCATGTCCAACGCCAACCACTGATA
AGCCACAGCAGAAAGAAGTGGAATTGCTAATGGAACAAAACTTTCTTTTGCGACATCGAGTGGAAATGCTTGAAG
GTGCTATGCAGGTTATGAAGAGGGAGATGAATGCTGTGAAGAGTGCGCTAGGCCCGTGGTACCGTATGCCTACAA
CACGCCCGACCTATTCCGCCCGAGCTCGTACCTCGCTACGGCCAGAAGGGGAAGAAGTAGCAGCTGAAATTACAA
ATGGGAATACCGGCCCATCACTCGATGCGGCAAATTCTTTGGGCGCGGGCGAGGGCAATACTGTGCAGGCGAGGG
CGACACACACGCGTAGACGATCATTGCCTTTGTCGGGAGAAATGATGGAGAATGGCGGGGATGGGATCCGTGAAG
GTGATCCCTTTGCTGGATACTTTCCTACGATCGGGGACTTTGGTGGATTACTGTCGCATCATGGGGCCTTTGCGC
AACAGCAGCAGCAGGGAGGAGGACCTGGTGGGCTTCAAATTAACCCGGGGGCTGTGACTAGGGTGGCGCCTTTGG
ATTTGGGGACAACTCTGATTGGGACATTGGAGGGACTACGAGAAAGCGTGGTTGGAGTTGCTGCGGGAATAGACT
CACTAGGAAGGAGAAGCGAAATTGCGTTGGCTAATGAAAGCTTACGGTTGGGAGAAGAGGTAGTTTCTATGCGGG
GGGCTGTTCATGGGTTGAGGATGCAGGTGGGTTTGCATACGTCTTTCAGCTGATCGGACCACTGATAAGCATTTA
GATCCATGCGATGATGATGGAGAGAAATGCGCAGATTACGGGGAGAGAGGAGGGGATGGGTGCCGGAAGCTCGTG
GATGGGTGGGGGGATGAATTTTGGTGGACAGAATGCCTCTGGACCGAGGATGTATTCTTATGGAGGACCACCGCC
GAACATCACAAAACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail