Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042380
Gene name
Locationscaffold_2:976432..981218
Strand+
Gene length (bp)4786
Transcript length (bp)4383
Coding sequence length (bp)4383
Protein length (aa) 1461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00169 PH PH domain 1.5E-06 1321 1430

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53705|BUD4_CANAL Bud site selection protein BUD4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD4 PE=1 SV=2 1091 1431 5.0E-28
sp|Q9P7Y8|MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mid2 PE=1 SV=2 1091 1442 1.0E-27
sp|Q751K7|BUD4_ASHGO Bud site selection protein 4 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BUD4 PE=3 SV=1 1278 1451 6.0E-14
sp|A7TM88|BUD4_VANPO Bud site selection protein 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BUD4 PE=3 SV=1 1299 1449 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042380
MATRKPIPLQDRLLSPSSDPIKSSILRDSGMGWASPAAIHMPSSSSSGSVTSPLRIAKRDSPALPQGPNVVRRTS
SSFKHVRNNNLVSKSPFKNKTQTPTPSTPSRPISVVFPIRRVSGEKRARPSSMHEDAETANDRPFSLKRDRKQSM
TFQGLLEREPVTKSPFKQKERVSSVDDAPPSPPSIPGFGYPSPHTAPLSSIDSHLTPVDDVTPTSATGSSPGRSS
LVSKRLHGPRLSGGWKRERRKTVTFDERCDVVEFDCDTSEEEYWEDSDDLAGRSHAYRDNDEVDPFFCEDPAVDE
VQLSEPDLHLAPDMSIDEVSHESTLNSGLHNPAAATLLNTDTSINGLVEEMFFSSNAALPDADLSGSKTPPRVFD
MPTDLETEDGVPFGRGHHAERSSQFHYQGSPRQYQPSPHFSPNAHSPSQTINIPSLSPGDKNPLSPNNIDSPTCS
SSRRPSITSFRDALEPMQSTPPPGRSTNIEEIIKFPEELMEEVDDPETHAGQLPTSPTPMKTTRSSMGRGEGFIP
KFKWPRGSQYPDRGSPSGGADTFDLDEHNRSSNDSLDPSNLSIGNSEVSLSGLDRSVSYHSGEEAPPESDLSNSS
FLKNDFQAGGIPSPAASNSSHDEVLAGISEDNHRNMPRLSPPSLLPGVTSPSIPLTSPLNLSQSSSPRAQSPHHR
ISKDDIRRRLTERRSTFSASPEPTRPFDPVMEQVPPNEPLFQDIIPQPEVLPTVATSFDKERDCISISTAMTDVS
LEPATVQHAERMDLAGSLPTPDSLSDKEFGVVNSSPSLQVTFGNKFTLGGMGFHGSETTAHSKASTARSSRGNEN
DDGSAHSGSNVKMGGVDVNMDMKSALDRLMDDVASAGGHEDSMITDEEDTSYDQSAEISPRKVHRAATDSDLLHM
AEASRGIFSGPSVSSIPPPLPPKDNQIKLREQLILEKRREARRAESGLPIPTRSNGQQLQAQLGVGRPTRRRSMS
ADDANDHVKKRLEQLPKIGNMEQLIEEDPLSQSIERELKKLRRNPSVAAKSKYQVREHESTIYASAPDETVSHMT
GVGDVDTGKAWKTVRRPSDMDEYSKQIKEYRSQANSGKSYGKVFVKVLGIKGVNIALPQEPTVLTCTLNNGIHYV
TTPESQLAPDCRIDQEFELIEHSKLEFTLTLKIRKDPHIVAQFKELTSKPAPAPPPSQPPVQQTSSRGMRSFFSS
SPKKPSKEKRALTPPPPVPPHRLPENFARHLKPDGTLARAFIQFRDIASRCDMRLFETSYPLIGQRVELGGKLST
LQVGEIVLQMFRLPPLPGIPPDQLPQSLEECHRGLRHINWHKMTYFQGTLTQSGGDCSTWRRRLFRVIGAKLVAF
NDVTKKATATIDLKKAIAVQDDQDLRNPLSPLARRRGYDEDELYGVERSFRLIFPHGQEIIFFADTDEEKVRWLE
VLRALVGHIPPHPLWAELLWHRQEDMSKRTPVSPR*
Coding >AgabiH97|042380
ATGGCAACTCGCAAACCCATCCCCCTGCAGGACCGTCTCCTCTCTCCTTCCTCAGATCCTATAAAATCTTCTATC
CTCCGCGACTCGGGCATGGGATGGGCTTCCCCGGCAGCGATTCATATGCCGTCTTCCTCCAGCTCAGGGTCCGTA
ACCTCTCCCTTGAGAATCGCAAAGCGAGACTCGCCCGCCCTCCCACAAGGACCCAATGTCGTACGGCGTACCTCT
TCAAGCTTCAAACACGTTCGCAACAACAATCTTGTCTCCAAGTCTCCTTTCAAAAATAAAACACAGACTCCCACC
CCTTCCACTCCCTCTCGTCCTATATCAGTCGTATTTCCAATTCGACGAGTGTCTGGAGAGAAACGAGCTCGTCCA
TCTTCAATGCATGAGGATGCAGAAACCGCCAATGATCGCCCCTTCTCTCTCAAGCGTGACAGAAAACAAAGCATG
ACATTTCAAGGCCTTCTGGAGAGAGAACCTGTCACTAAGAGTCCCTTCAAACAGAAGGAGCGGGTATCCAGTGTG
GATGATGCTCCTCCTTCCCCTCCTTCCATCCCCGGATTTGGATATCCAAGCCCTCATACAGCTCCCTTATCTTCT
ATCGATTCCCATCTTACTCCCGTTGACGATGTTACTCCCACTTCAGCCACAGGCTCTTCACCAGGAAGGTCTTCC
CTCGTTTCTAAGCGTCTACATGGGCCGCGCCTCAGTGGCGGGTGGAAGCGAGAGCGCAGAAAAACCGTTACCTTC
GACGAACGATGCGATGTTGTTGAATTTGACTGTGATACCTCGGAAGAAGAATACTGGGAGGACTCCGATGATCTG
GCAGGTCGCAGCCACGCATACCGGGATAATGACGAGGTCGACCCATTCTTCTGCGAAGACCCCGCCGTAGACGAA
GTACAACTGTCCGAGCCGGATCTTCACCTCGCACCCGACATGTCGATAGACGAAGTCTCGCACGAGAGCACTCTA
AATTCTGGTCTCCACAATCCAGCCGCCGCGACGCTTTTAAATACAGATACCAGCATTAACGGGCTCGTTGAGGAG
ATGTTTTTTTCTTCAAACGCTGCTCTCCCTGATGCAGATTTATCAGGATCTAAAACACCTCCTCGCGTATTCGAT
ATGCCCACCGATCTTGAGACGGAGGATGGTGTTCCTTTCGGTCGGGGTCATCATGCTGAACGCTCGTCACAATTT
CACTATCAAGGCTCCCCTCGACAATATCAACCTTCTCCTCACTTTTCTCCAAATGCGCACTCTCCTTCTCAAACT
ATCAATATCCCTTCACTCTCACCCGGGGATAAAAATCCCTTATCCCCAAATAACATTGATTCCCCCACCTGCTCG
TCATCGCGCCGGCCTTCTATCACATCTTTTCGCGATGCTTTGGAGCCCATGCAAAGCACACCACCCCCTGGTCGG
TCGACAAATATAGAAGAAATCATAAAATTCCCTGAAGAATTAATGGAAGAAGTAGATGATCCTGAGACGCATGCC
GGGCAACTGCCTACGAGTCCCACGCCGATGAAAACTACAAGGTCTTCGATGGGTCGTGGCGAGGGGTTTATTCCA
AAATTCAAGTGGCCGCGGGGATCTCAATATCCTGATCGGGGTTCCCCTTCCGGTGGAGCAGATACGTTTGATCTC
GATGAACATAACCGGTCCAGCAATGATTCTTTGGATCCTAGTAACCTTTCCATAGGCAACTCTGAGGTTAGCTTG
AGCGGTCTGGATAGGAGTGTCAGCTATCATTCCGGTGAAGAGGCACCCCCAGAATCAGACCTTAGTAATTCGTCG
TTTTTAAAGAATGATTTTCAAGCAGGAGGTATCCCTTCCCCCGCGGCCTCCAATTCCTCTCACGACGAAGTACTT
GCGGGTATCAGTGAAGACAATCATAGGAACATGCCCAGGCTTTCGCCCCCATCATTGCTTCCTGGTGTCACCTCC
CCGTCAATTCCTCTCACCTCACCTCTTAACTTGAGCCAAAGTAGTAGTCCTCGTGCACAGTCTCCTCATCATCGC
ATCAGCAAAGACGACATTCGTCGTCGTCTTACCGAAAGGAGAAGCACATTTAGTGCCAGTCCTGAACCCACGCGC
CCGTTTGACCCGGTTATGGAACAGGTACCTCCAAACGAACCTTTATTCCAGGACATCATCCCTCAACCAGAAGTA
CTTCCCACTGTTGCTACCAGCTTTGACAAGGAGCGTGATTGCATATCAATCTCGACGGCCATGACTGATGTCAGC
CTTGAGCCCGCCACCGTACAACACGCGGAAAGGATGGATCTTGCAGGTAGCTTACCTACACCAGACAGTCTCTCC
GACAAAGAATTTGGAGTGGTCAACTCCAGCCCGAGTTTGCAAGTAACCTTTGGTAACAAGTTCACCCTTGGAGGC
ATGGGCTTCCATGGTAGTGAAACCACAGCGCATTCCAAAGCGAGCACTGCCCGTTCCTCCCGTGGTAACGAAAAT
GACGACGGGAGTGCCCATAGTGGTAGCAATGTGAAGATGGGAGGTGTGGATGTGAATATGGACATGAAAAGTGCC
CTGGATAGGCTGATGGATGATGTTGCCAGCGCGGGCGGCCATGAGGATTCTATGATCACTGACGAAGAAGACACT
TCGTATGATCAATCAGCTGAGATCAGCCCACGTAAGGTTCACCGAGCGGCAACAGATTCTGACTTGTTACATATG
GCTGAAGCATCCCGAGGAATATTTTCTGGCCCTTCCGTTTCATCGATACCTCCTCCCCTCCCCCCAAAAGATAAC
CAGATCAAGCTTCGCGAACAGCTTATCTTAGAAAAAAGGAGGGAGGCTCGTAGGGCTGAGAGTGGTCTTCCGATA
CCCACGCGGAGCAACGGGCAACAATTACAAGCGCAATTAGGAGTTGGACGGCCAACCAGGAGGCGTAGCATGAGT
GCTGATGATGCAAACGATCATGTCAAAAAACGGCTGGAGCAACTGCCCAAGATTGGAAATATGGAACAGCTCATT
GAGGAGGATCCACTCTCTCAGAGCATTGAGCGTGAACTGAAAAAACTACGCCGAAATCCATCTGTTGCAGCGAAG
AGTAAATATCAAGTTCGAGAACATGAAAGCACTATTTACGCTTCAGCTCCTGATGAGACGGTTTCGCATATGACG
GGCGTCGGAGACGTTGACACGGGGAAAGCATGGAAGACAGTCCGCCGACCTTCTGATATGGATGAGTACTCGAAG
CAAATCAAAGAATACCGTTCACAAGCCAATTCAGGAAAATCATATGGAAAGGTTTTCGTTAAGGTTCTGGGAATC
AAAGGAGTGAACATTGCGCTGCCACAAGAGCCTACGGTCCTTACATGTACTCTGAATAATGGCATACATTATGTG
ACGACTCCGGAAAGCCAGCTTGCTCCCGACTGCCGCATTGATCAAGAATTCGAGCTAATTGAACACAGTAAACTT
GAATTCACCTTGACATTGAAAATCCGCAAGGATCCTCATATCGTCGCCCAATTCAAGGAATTGACGTCGAAGCCT
GCTCCAGCACCTCCACCATCCCAACCTCCTGTTCAGCAAACATCCTCGAGAGGAATGCGCTCATTTTTTTCTTCG
TCTCCTAAGAAGCCATCCAAGGAGAAGCGAGCTCTGACACCGCCCCCGCCTGTACCTCCTCACCGACTCCCGGAG
AACTTTGCGCGCCACCTCAAACCGGATGGCACACTTGCTCGCGCATTTATCCAATTCAGGGATATCGCTTCACGA
TGTGACATGCGCTTATTTGAAACAAGTTATCCGTTGATCGGACAACGTGTTGAATTGGGTGGAAAACTTTCTACC
CTACAGGTAGGAGAGATCGTTTTGCAGATGTTTAGATTGCCGCCTTTGCCCGGCATTCCACCTGATCAACTACCT
CAAAGCTTAGAAGAATGCCATCGTGGTCTCCGGCATATTAATTGGCATAAGATGACTTATTTCCAAGGAACCCTA
ACACAGAGTGGTGGGGATTGTAGTACCTGGCGCCGACGCCTCTTTCGCGTCATTGGCGCCAAATTGGTTGCCTTC
AATGACGTTACCAAGAAGGCTACTGCAACGATTGATTTGAAGAAAGCCATCGCAGTCCAAGACGACCAAGATTTA
CGTAATCCGCTCAGTCCTCTCGCCCGCAGACGGGGATATGATGAAGATGAACTATATGGTGTGGAACGGTCATTC
CGACTTATATTCCCTCATGGGCAGGAGATCATCTTTTTTGCCGACACCGACGAAGAGAAAGTCAGATGGCTTGAG
GTCCTTCGTGCACTCGTCGGCCATATCCCACCTCATCCACTTTGGGCTGAATTGCTTTGGCACCGGCAGGAAGAT
ATGTCCAAGCGGACACCAGTATCTCCGCGTTAG
Transcript >AgabiH97|042380
ATGGCAACTCGCAAACCCATCCCCCTGCAGGACCGTCTCCTCTCTCCTTCCTCAGATCCTATAAAATCTTCTATC
CTCCGCGACTCGGGCATGGGATGGGCTTCCCCGGCAGCGATTCATATGCCGTCTTCCTCCAGCTCAGGGTCCGTA
ACCTCTCCCTTGAGAATCGCAAAGCGAGACTCGCCCGCCCTCCCACAAGGACCCAATGTCGTACGGCGTACCTCT
TCAAGCTTCAAACACGTTCGCAACAACAATCTTGTCTCCAAGTCTCCTTTCAAAAATAAAACACAGACTCCCACC
CCTTCCACTCCCTCTCGTCCTATATCAGTCGTATTTCCAATTCGACGAGTGTCTGGAGAGAAACGAGCTCGTCCA
TCTTCAATGCATGAGGATGCAGAAACCGCCAATGATCGCCCCTTCTCTCTCAAGCGTGACAGAAAACAAAGCATG
ACATTTCAAGGCCTTCTGGAGAGAGAACCTGTCACTAAGAGTCCCTTCAAACAGAAGGAGCGGGTATCCAGTGTG
GATGATGCTCCTCCTTCCCCTCCTTCCATCCCCGGATTTGGATATCCAAGCCCTCATACAGCTCCCTTATCTTCT
ATCGATTCCCATCTTACTCCCGTTGACGATGTTACTCCCACTTCAGCCACAGGCTCTTCACCAGGAAGGTCTTCC
CTCGTTTCTAAGCGTCTACATGGGCCGCGCCTCAGTGGCGGGTGGAAGCGAGAGCGCAGAAAAACCGTTACCTTC
GACGAACGATGCGATGTTGTTGAATTTGACTGTGATACCTCGGAAGAAGAATACTGGGAGGACTCCGATGATCTG
GCAGGTCGCAGCCACGCATACCGGGATAATGACGAGGTCGACCCATTCTTCTGCGAAGACCCCGCCGTAGACGAA
GTACAACTGTCCGAGCCGGATCTTCACCTCGCACCCGACATGTCGATAGACGAAGTCTCGCACGAGAGCACTCTA
AATTCTGGTCTCCACAATCCAGCCGCCGCGACGCTTTTAAATACAGATACCAGCATTAACGGGCTCGTTGAGGAG
ATGTTTTTTTCTTCAAACGCTGCTCTCCCTGATGCAGATTTATCAGGATCTAAAACACCTCCTCGCGTATTCGAT
ATGCCCACCGATCTTGAGACGGAGGATGGTGTTCCTTTCGGTCGGGGTCATCATGCTGAACGCTCGTCACAATTT
CACTATCAAGGCTCCCCTCGACAATATCAACCTTCTCCTCACTTTTCTCCAAATGCGCACTCTCCTTCTCAAACT
ATCAATATCCCTTCACTCTCACCCGGGGATAAAAATCCCTTATCCCCAAATAACATTGATTCCCCCACCTGCTCG
TCATCGCGCCGGCCTTCTATCACATCTTTTCGCGATGCTTTGGAGCCCATGCAAAGCACACCACCCCCTGGTCGG
TCGACAAATATAGAAGAAATCATAAAATTCCCTGAAGAATTAATGGAAGAAGTAGATGATCCTGAGACGCATGCC
GGGCAACTGCCTACGAGTCCCACGCCGATGAAAACTACAAGGTCTTCGATGGGTCGTGGCGAGGGGTTTATTCCA
AAATTCAAGTGGCCGCGGGGATCTCAATATCCTGATCGGGGTTCCCCTTCCGGTGGAGCAGATACGTTTGATCTC
GATGAACATAACCGGTCCAGCAATGATTCTTTGGATCCTAGTAACCTTTCCATAGGCAACTCTGAGGTTAGCTTG
AGCGGTCTGGATAGGAGTGTCAGCTATCATTCCGGTGAAGAGGCACCCCCAGAATCAGACCTTAGTAATTCGTCG
TTTTTAAAGAATGATTTTCAAGCAGGAGGTATCCCTTCCCCCGCGGCCTCCAATTCCTCTCACGACGAAGTACTT
GCGGGTATCAGTGAAGACAATCATAGGAACATGCCCAGGCTTTCGCCCCCATCATTGCTTCCTGGTGTCACCTCC
CCGTCAATTCCTCTCACCTCACCTCTTAACTTGAGCCAAAGTAGTAGTCCTCGTGCACAGTCTCCTCATCATCGC
ATCAGCAAAGACGACATTCGTCGTCGTCTTACCGAAAGGAGAAGCACATTTAGTGCCAGTCCTGAACCCACGCGC
CCGTTTGACCCGGTTATGGAACAGGTACCTCCAAACGAACCTTTATTCCAGGACATCATCCCTCAACCAGAAGTA
CTTCCCACTGTTGCTACCAGCTTTGACAAGGAGCGTGATTGCATATCAATCTCGACGGCCATGACTGATGTCAGC
CTTGAGCCCGCCACCGTACAACACGCGGAAAGGATGGATCTTGCAGGTAGCTTACCTACACCAGACAGTCTCTCC
GACAAAGAATTTGGAGTGGTCAACTCCAGCCCGAGTTTGCAAGTAACCTTTGGTAACAAGTTCACCCTTGGAGGC
ATGGGCTTCCATGGTAGTGAAACCACAGCGCATTCCAAAGCGAGCACTGCCCGTTCCTCCCGTGGTAACGAAAAT
GACGACGGGAGTGCCCATAGTGGTAGCAATGTGAAGATGGGAGGTGTGGATGTGAATATGGACATGAAAAGTGCC
CTGGATAGGCTGATGGATGATGTTGCCAGCGCGGGCGGCCATGAGGATTCTATGATCACTGACGAAGAAGACACT
TCGTATGATCAATCAGCTGAGATCAGCCCACGTAAGGTTCACCGAGCGGCAACAGATTCTGACTTGTTACATATG
GCTGAAGCATCCCGAGGAATATTTTCTGGCCCTTCCGTTTCATCGATACCTCCTCCCCTCCCCCCAAAAGATAAC
CAGATCAAGCTTCGCGAACAGCTTATCTTAGAAAAAAGGAGGGAGGCTCGTAGGGCTGAGAGTGGTCTTCCGATA
CCCACGCGGAGCAACGGGCAACAATTACAAGCGCAATTAGGAGTTGGACGGCCAACCAGGAGGCGTAGCATGAGT
GCTGATGATGCAAACGATCATGTCAAAAAACGGCTGGAGCAACTGCCCAAGATTGGAAATATGGAACAGCTCATT
GAGGAGGATCCACTCTCTCAGAGCATTGAGCGTGAACTGAAAAAACTACGCCGAAATCCATCTGTTGCAGCGAAG
AGTAAATATCAAGTTCGAGAACATGAAAGCACTATTTACGCTTCAGCTCCTGATGAGACGGTTTCGCATATGACG
GGCGTCGGAGACGTTGACACGGGGAAAGCATGGAAGACAGTCCGCCGACCTTCTGATATGGATGAGTACTCGAAG
CAAATCAAAGAATACCGTTCACAAGCCAATTCAGGAAAATCATATGGAAAGGTTTTCGTTAAGGTTCTGGGAATC
AAAGGAGTGAACATTGCGCTGCCACAAGAGCCTACGGTCCTTACATGTACTCTGAATAATGGCATACATTATGTG
ACGACTCCGGAAAGCCAGCTTGCTCCCGACTGCCGCATTGATCAAGAATTCGAGCTAATTGAACACAGTAAACTT
GAATTCACCTTGACATTGAAAATCCGCAAGGATCCTCATATCGTCGCCCAATTCAAGGAATTGACGTCGAAGCCT
GCTCCAGCACCTCCACCATCCCAACCTCCTGTTCAGCAAACATCCTCGAGAGGAATGCGCTCATTTTTTTCTTCG
TCTCCTAAGAAGCCATCCAAGGAGAAGCGAGCTCTGACACCGCCCCCGCCTGTACCTCCTCACCGACTCCCGGAG
AACTTTGCGCGCCACCTCAAACCGGATGGCACACTTGCTCGCGCATTTATCCAATTCAGGGATATCGCTTCACGA
TGTGACATGCGCTTATTTGAAACAAGTTATCCGTTGATCGGACAACGTGTTGAATTGGGTGGAAAACTTTCTACC
CTACAGGTAGGAGAGATCGTTTTGCAGATGTTTAGATTGCCGCCTTTGCCCGGCATTCCACCTGATCAACTACCT
CAAAGCTTAGAAGAATGCCATCGTGGTCTCCGGCATATTAATTGGCATAAGATGACTTATTTCCAAGGAACCCTA
ACACAGAGTGGTGGGGATTGTAGTACCTGGCGCCGACGCCTCTTTCGCGTCATTGGCGCCAAATTGGTTGCCTTC
AATGACGTTACCAAGAAGGCTACTGCAACGATTGATTTGAAGAAAGCCATCGCAGTCCAAGACGACCAAGATTTA
CGTAATCCGCTCAGTCCTCTCGCCCGCAGACGGGGATATGATGAAGATGAACTATATGGTGTGGAACGGTCATTC
CGACTTATATTCCCTCATGGGCAGGAGATCATCTTTTTTGCCGACACCGACGAAGAGAAAGTCAGATGGCTTGAG
GTCCTTCGTGCACTCGTCGGCCATATCCCACCTCATCCACTTTGGGCTGAATTGCTTTGGCACCGGCAGGAAGAT
ATGTCCAAGCGGACACCAGTATCTCCGCGTTAG
Gene >AgabiH97|042380
ATGGCAACTCGCAAACCCATCCCCCTGCAGGACCGTCTCCTCTCTCCTTCCTCAGATCCTATAAAATCTTCTATC
CTCCGCGACTCGGGCATGGGATGGGCTTCCCCGGCAGCGATTCATATGCCGTCTTCCTCCAGCTCAGGGTCCGTA
ACCTCTCCCTTGAGAATCGCAAAGCGAGACTCGCCCGCCCTCCCACAAGGACCCAATGTCGTACGGCGTACCTCT
TCAAGCTTCAAACACGTTCGCAACAACAATCTTGTCTCCAAGTCTCCTTTCAAAAATAAAACACAGACTCCCACC
CCTTCCACTCCCTCTCGTCCTATATCAGTCGTATTTCCAATTCGACGAGTGTCTGGAGAGAAACGAGCTCGTCCA
TCTTCAATGCATGAGGATGCAGAAACCGCCAATGATCGCCCCTTCTCTCTCAAGCGTGACAGAAAACAAAGCATG
ACATTTCAAGGCCTTCTGGAGAGAGAACCTGTCACTAAGAGTCCCTTCAAACAGAAGGAGCGGGTATCCAGTGTG
GATGATGCTCCTCCTTCCCCTCCTTCCATCCCCGGATTTGGATATCCAAGCCCTCATACAGCTCCCTTATCTTCT
ATCGATTCCCATCTTACTCCCGTTGACGATGTTACTCCCACTTCAGCCACAGGCTCTTCACCAGGAAGGTCTTCC
CTCGTTTCTAAGCGTCTACATGGGCCGCGCCTCAGTGGCGGGTGGAAGCGAGAGCGCAGAAAAACCGTTACCTTC
GACGAACGATGCGATGTTGTTGAATTTGACTGTGATACCTCGGAAGAAGAATACTGGGAGGACTCCGATGATCTG
GCAGGTCGCAGCCACGCATACCGGGATAATGACGAGGTCGACCCATTCTTCTGCGAAGACCCCGCCGTAGACGAA
GTACAACTGTCCGAGCCGGATCTTCACCTCGCACCCGACATGTCGATAGACGAAGTCTCGCACGAGAGCACTCTA
AATTCTGGTCTCCACAATCCAGCCGCCGCGACGCTTTTAAATACAGATACCAGCATTAACGGGCTCGTTGAGGAG
ATGTTTTTTTCTTCAAACGCTGCTCTCCCTGATGCAGATTTATCAGGATCTAAAACACCTCCTCGCGTATTCGAT
ATGCCCACCGATCTTGAGACGGAGGATGGTGTTCCTTTCGGTCGGGGTCATCATGCTGAACGCTCGTCACAATTT
CACTATCAAGGCTCCCCTCGACAATATCAACCTTCTCCTCACTTTTCTCCAAATGCGCACTCTCCTTCTCAAACT
ATCAATATCCCTTCACTCTCACCCGGGGATAAAAATCCCTTATCCCCAAATAACATTGATTCCCCCACCTGCTCG
TCATCGCGCCGGCCTTCTATCACATCTTTTCGCGATGCTTTGGAGCCCATGCAAAGCACACCACCCCCTGGTCGG
TCGACAAATATAGAAGAAATCATAAAATTCCCTGAAGAATTAATGGAAGAAGTAGATGATCCTGAGACGCATGCC
GGGCAACTGCCTACGAGTCCCACGCCGATGAAAACTACAAGGTCTTCGATGGGTCGTGGCGAGGGGTTTATTCCA
AAATTCAAGTGGCCGCGGGGTGAGTTGTTTTTTCACCTCGTCGTTATTAGTTGTTTAGCTTGCAGGATCTCAATA
TCCTGATCGGGGTTCCCCTTCCGGTGGAGCAGATACGTTTGATCTCGATGAACATAACCGGTCCAGCAATGATTC
TTTGGATCCTAGTAACCTTTCCATAGGCAACTCTGAGGTTAGCTTGAGCGGTCTGGATAGGAGTGTCAGCTATCA
TTCCGGTGAAGAGGTAAAATTCTCGCAACCAATTCCAGTAATTGTTCGCTGATCGAGAATCAGGCACCCCCAGAA
TCAGACCTTAGTAATTCGTCGTTTTTAAAGAATGATTTTCAAGCAGGAGGTATCCCTTCCCCCGCGGCCTCCAAT
TCCTCTCACGACGAAGTACTTGCGGGTATCAGTGAAGACAATCATAGGAACATGCCCAGGCTTTCGCCCCCATCA
TTGCTTCCTGGTGTCACCTCCCCGTCAATTCCTCTCACCTCACCTCTTAACTTGAGCCAAAGTAGTAGTCCTCGT
GCACAGTCTCCTCATCATCGCATCAGCAAAGACGACATTCGTCGTCGTCTTACCGAAAGGAGAAGCACATTTAGT
GCCAGTCCTGAACCCACGCGCCCGTTTGACCCGGTTATGGAACAGGTACCTCCAAACGAACCTTTATTCCAGGAC
ATCATCCCTCAACCAGAAGTACTTCCCACTGTTGCTACCAGCTTTGACAAGGAGCGTGATTGCATATCAATCTCG
ACGGCCATGACTGATGTCAGCCTTGAGCCCGCCACCGTACAACACGCGGAAAGGATGGATCTTGCAGGTAGCTTA
CCTACACCAGACAGTCTCTCCGACAAAGAATTTGGAGTGGTCAACTCCAGCCCGAGTTTGCAAGTAACCTTTGGT
AACAAGTTCACCCTTGGAGGCATGGGCTTCCATGGTAGTGAAACCACAGCGCATTCCAAAGCGAGCACTGCCCGT
TCCTCCCGTGGTAACGAAAATGACGACGGGAGTGCCCATAGTGGTAGCAATGTGAAGATGGGAGGTGTGGATGTG
AATATGGACATGAAAAGTGCCCTGGATAGGCTGATGGATGATGTTGCCAGCGCGGGCGGCCATGAGGATTCTATG
ATCACTGACGAAGAAGACACTTCGTATGATCAATCAGCTGAGATCAGCCCACGTAAGGTTCACCGAGCGGCAACA
GATTCTGACTTGTTACATATGGCTGAAGCATCCCGAGGAATATTTTCTGGCCCTTCCGTTTCATCGATACCTCCT
CCCCTCCCCCCAAAAGATAACCAGATCAAGCTTCGCGAACAGCTTATCTTAGAAAAAAGGAGGGAGGCTCGTAGG
GCTGAGAGTGGTCTTCCGATACCCACGCGGAGCAACGGGCAACAATTACAAGCGCAATTAGGAGTTGGACGGCCA
ACCAGGAGGCGTAGCATGAGTGCTGATGATGCAAACGATCATGTCAAAAAACGGCTGGAGCAACTGCCCAAGATT
GGAAATATGGAACAGCTCATTGAGGAGGATCCACTCTCTCAGAGCATTGAGCGTGAACTGAAAAAACTACGCCGA
AATCCATCTGTTGCAGCGAAGAGTGTAGGTGTTTTCTCCTGCTGGTAAGTTTCCAAGCTCATTGCCTCTTTCAGA
AATATCAAGTTCGAGAACATGAAAGCACTATTTACGCTTCAGCTCCTGATGAGACGGTTTCGCATATGACGGGCG
TCGGAGACGTTGACACGGGGAAAGCATGGAAGACAGTCCGCCGACCTTCTGATATGGTAAGCATTATAAAGAGGA
ATTTTAGGCTAGATACTGACCGATTGAACAGGATGAGTACTCGAAGCAAATCAAAGAATACCGTTCACAAGCCAA
TTCAGGAAAATCATATGGAAAGGTTTTCGTTAAGGGTAAGTCTATATCAAGACTAGAAAATTTTCGATGCCAATT
TTCTGTTTAGTTCTGGGAATCAAAGGAGTGAACATTGCGCTGCCACAAGAGCCTACGGTCCTTACATGTACTCTG
AATAATGGCATACATTATGTGACGACTCCGGAAAGCCAGCTTGCTCCCGACTGCCGCATTGATCAAGAATTCGAG
CTGTGAGCCATGGTACCTGCTTTACAATAAAGTTATTCTAACACAATTCATAGAATTGAACACAGTAAACTTGAA
TTCACCTTGACATTGAAAATCCGCAAGGATCCTCATATCGTCGCCCAATTCAAGGAATTGACGTCGAAGCCTGCT
CCAGCACCTCCACCATCCCAACCTCCTGTTCAGCAAACATCCTCGAGAGGAATGCGCTCATTTTTTTCTTCGTCT
CCTAAGAAGCCATCCAAGGAGAAGCGAGCTCTGACACCGCCCCCGCCTGTACCTCCTCACCGACTCCCGGAGAAC
TTTGCGCGCCACCTCAAACCGGATGGCACACTTGCTCGCGCATTTATCCAATTCAGGGATATCGCTTCACGATGT
GACATGCGCTTATTTGAAACAAGTTATCCGTTGATCGGACAACGTGTTGAATTGGGTGGAAAACTTTCTACCCTA
CAGGTAGGAGAGATCGTTTTGCAGATGTTTAGATTGCCGCCTTTGCCCGGCATTCCACCTGATCAACTACCTCAA
AGCTTAGAAGAATGCCATCGTGGTCTCCGGCATATTAATTGGCATAAGATGACTTATTTCCAAGGAACCCTAACA
CAGAGTGGTGGGGATTGTAGTGTGGGTAACTTTAGATTCACCCTTGGACTTCGCGACTGATATAATCTAACATAG
ACCTGGCGCCGACGCCTCTTTCGCGTCATTGGCGCCAAATTGGTTGCCTTCAATGACGTTACCAAGAAGGCTACT
GCAACGATTGATTTGAAGAAAGCCATCGCAGTCCAAGACGACCAAGATTTACGTAATCCGCTCAGTCCTCTCGCC
CGCAGACGGGGATATGATGAAGATGAACTATATGGTGTGGAACGGTCATTCCGACTTATATTCCCTCATGGGCAG
GAGATCATCTTTTTTGCCGACACCGACGAAGAGAAAGTCAGATGGTAAGTAATACATGCTTTGGAATTTTGTTTG
AGGCTGATCGATGACCTTTAGGCTTGAGGTCCTTCGTGCACTCGTCGGCCATATCCCACCTCATCCACTTTGGGC
TGAATTGCTTTGGCACCGGCAGGAAGATATGTCCAAGCGGACACCAGTATCTCCGCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail