Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042130
Gene name
Locationscaffold_2:911000..913926
Strand+
Gene length (bp)2926
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05879 RHD3_GTPase Root hair defective 3 GTP-binding protein (RHD3) GTPase domain 1.5E-112 69 307
PF20428 Sey1_3HB Sey1 three-helix bundle domain 1.5E-103 348 745
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.8E-06 66 134
PF02263 GBP Guanylate-binding protein, N-terminal domain 8.1E-06 65 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XQZ0|SEY1_ASPFC Protein sey1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sey1 PE=3 SV=1 12 783 0.0E+00
sp|Q2UNK6|SEY1_ASPOR Protein sey1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sey1 PE=3 SV=2 18 792 0.0E+00
sp|B8MK20|SEY1_TALSN Protein sey1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sey1 PE=3 SV=1 3 787 0.0E+00
sp|A6S544|SEY1_BOTFB Protein sey1 OS=Botryotinia fuckeliana (strain B05.10) GN=sey1 PE=3 SV=1 34 759 0.0E+00
sp|Q0V302|SEY1_PHANO Protein SEY1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEY1 PE=3 SV=2 34 779 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XQZ0|SEY1_ASPFC Protein sey1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sey1 PE=3 SV=1 12 783 0.0E+00
sp|Q2UNK6|SEY1_ASPOR Protein sey1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sey1 PE=3 SV=2 18 792 0.0E+00
sp|B8MK20|SEY1_TALSN Protein sey1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sey1 PE=3 SV=1 3 787 0.0E+00
sp|A6S544|SEY1_BOTFB Protein sey1 OS=Botryotinia fuckeliana (strain B05.10) GN=sey1 PE=3 SV=1 34 759 0.0E+00
sp|Q0V302|SEY1_PHANO Protein SEY1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEY1 PE=3 SV=2 34 779 0.0E+00
sp|B2W244|SEY1_PYRTR Protein sey1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sey1 PE=3 SV=2 28 759 0.0E+00
sp|B6GX67|SEY1_PENRW Protein sey1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sey1 PE=3 SV=1 12 759 0.0E+00
sp|Q525S7|SEY1_MAGO7 Protein SEY1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEY1 PE=3 SV=1 3 777 0.0E+00
sp|A1D2K1|SEY1_NEOFI Protein sey1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sey1 PE=3 SV=1 12 783 0.0E+00
sp|Q8TGG5|SEY1_ASPFU Protein sey1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sey1 PE=3 SV=1 12 783 0.0E+00
sp|C5FJT2|SEY1_ARTOC Protein SEY1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SEY1 PE=3 SV=1 34 783 0.0E+00
sp|Q5BEE5|SEY1_EMENI Protein sey1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sey1 PE=3 SV=1 18 759 0.0E+00
sp|Q2GUT7|SEY1_CHAGB Protein SEY1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEY1 PE=3 SV=2 34 775 0.0E+00
sp|Q9P5X6|SEY1_NEUCR Protein sey1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sey1 PE=3 SV=1 3 776 0.0E+00
sp|B2B1M4|SEY1_PODAN Protein SEY1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SEY1 PE=3 SV=1 34 774 0.0E+00
sp|A2QR20|SEY1_ASPNC Protein sey1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sey1 PE=3 SV=1 1 759 0.0E+00
sp|A1CPP3|SEY1_ASPCL Protein sey1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sey1 PE=3 SV=2 34 759 0.0E+00
sp|Q6C3B0|SEY1_YARLI Protein SEY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEY1 PE=3 SV=1 29 759 0.0E+00
sp|B0D0N9|SEY1_LACBS Protein SEY1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=SEY1 PE=3 SV=1 15 774 0.0E+00
sp|C1GWM2|SEY1_PARBA Protein SEY1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SEY1 PE=3 SV=2 34 781 0.0E+00
sp|A8N5E5|SEY1_COPC7 Protein SEY1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEY1 PE=3 SV=1 15 757 0.0E+00
sp|P0CQ46|SEY1_CRYNJ Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEY1 PE=3 SV=1 22 777 0.0E+00
sp|P0CQ47|SEY1_CRYNB Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEY1 PE=3 SV=1 22 777 0.0E+00
sp|Q4PEQ0|SEY1_USTMA Protein SEY1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEY1 PE=3 SV=2 8 773 0.0E+00
sp|A8QAN4|SEY1_MALGO Protein SEY1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=SEY1 PE=3 SV=1 33 764 0.0E+00
sp|B6QIM3|SEY1_TALMQ Protein sey1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sey1 PE=3 SV=2 2 773 0.0E+00
sp|C4JQN4|SEY1_UNCRE Protein SEY1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SEY1 PE=3 SV=1 12 761 0.0E+00
sp|C1G4S9|SEY1_PARBD Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SEY1 PE=3 SV=1 34 781 0.0E+00
sp|C0S6S4|SEY1_PARBP Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SEY1 PE=3 SV=1 34 781 0.0E+00
sp|Q1DL22|SEY1_COCIM Protein SEY1 OS=Coccidioides immitis (strain RS) GN=SEY1 PE=3 SV=1 34 761 0.0E+00
sp|A7ERA6|SEY1_SCLS1 Protein sey1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sey1 PE=3 SV=1 34 759 0.0E+00
sp|Q0D0W7|SEY1_ASPTN Protein sey1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sey1 PE=3 SV=1 18 781 0.0E+00
sp|B8NJL4|SEY1_ASPFN Protein sey1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sey1 PE=3 SV=1 18 792 0.0E+00
sp|A6R1D5|SEY1_AJECN Protein SEY1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SEY1 PE=3 SV=1 26 789 0.0E+00
sp|C5K3E1|SEY1_AJEDS Protein SEY1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SEY1 PE=3 SV=1 12 777 0.0E+00
sp|C5GMK3|SEY1_AJEDR Protein SEY1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SEY1 PE=3 SV=1 12 777 0.0E+00
sp|C0NJ57|SEY1_AJECG Protein SEY1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SEY1 PE=3 SV=1 12 789 0.0E+00
sp|B6K0N7|SEY1_SCHJY Protein sey1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=sey1 PE=3 SV=1 35 773 4.0E-177
sp|Q9UTE0|SEY1_SCHPO Protein sey1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sey1 PE=1 SV=1 35 755 1.0E-175
sp|C4YS65|SEY1_CANAW Protein SEY1 OS=Candida albicans (strain WO-1) GN=SEY1 PE=3 SV=1 34 759 6.0E-173
sp|Q9C0L9|SEY1_CANAL Protein SEY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEY1 PE=1 SV=2 34 759 6.0E-173
sp|B9WJF2|SEY1_CANDC Protein SEY1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SEY1 PE=3 SV=1 34 759 8.0E-169
sp|A3LWM9|SEY1_PICST Protein SEY1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEY1 PE=3 SV=2 34 779 5.0E-168
sp|B5VS52|SEY1_YEAS6 Protein SEY1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SEY1 PE=3 SV=1 34 760 5.0E-167
sp|Q99287|SEY1_YEAST Protein SEY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEY1 PE=1 SV=1 34 760 8.0E-167
sp|B3LJJ8|SEY1_YEAS1 Protein SEY1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SEY1 PE=3 SV=1 34 760 3.0E-166
sp|A6ZP10|SEY1_YEAS7 Protein SEY1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SEY1 PE=3 SV=1 34 760 1.0E-165
sp|C4Y2Z9|SEY1_CLAL4 Protein SEY1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=SEY1 PE=3 SV=1 34 757 1.0E-164
sp|Q6FLC5|SEY1_CANGA Protein SEY1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEY1 PE=3 SV=1 30 757 6.0E-164
sp|A5E240|SEY1_LODEL Protein SEY1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEY1 PE=3 SV=1 34 759 2.0E-163
sp|A7TJY3|SEY1_VANPO Protein SEY1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SEY1 PE=3 SV=1 28 773 1.0E-161
sp|C4R432|SEY1_PICPG Protein SEY1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEY1 PE=3 SV=1 34 765 3.0E-160
sp|C5DTA7|SEY1_ZYGRC Protein SEY1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SEY1 PE=3 SV=1 34 785 4.0E-159
sp|Q74ZD5|SEY1_ASHGO Protein SEY1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEY1 PE=3 SV=1 32 781 1.0E-156
sp|Q6BK59|SEY1_DEBHA Protein SEY1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEY1 PE=3 SV=2 34 759 7.0E-156
sp|A5DB26|SEY1_PICGU Protein SEY1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEY1 PE=3 SV=3 28 759 4.0E-155
sp|C5MCD3|SEY1_CANTT Protein SEY1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SEY1 PE=3 SV=2 34 759 6.0E-154
sp|C5DEL5|SEY1_LACTC Protein SEY1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=SEY1 PE=3 SV=1 32 781 2.0E-150
sp|Q6CJ97|SEY1_KLULA Protein SEY1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEY1 PE=3 SV=1 32 775 5.0E-142
sp|Q54W90|SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum GN=DDB_0206311 PE=3 SV=1 38 743 1.0E-121
sp|C4M6U3|SEY12_ENTHI Protein SEY1 homolog 2 OS=Entamoeba histolytica GN=EHI_054180 PE=3 SV=1 11 734 4.0E-103
sp|B0EKR0|SEY12_ENTDS Protein SEY1 homolog 2 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_026070 PE=3 SV=1 11 734 5.0E-100
sp|A2EI35|SEY11_TRIVA Protein SEY1 homolog 1 OS=Trichomonas vaginalis GN=TVAG_273580 PE=3 SV=1 35 732 2.0E-94
sp|A2EK80|SEY12_TRIVA Protein SEY1 homolog 2 OS=Trichomonas vaginalis GN=TVAG_100140 PE=3 SV=1 35 732 3.0E-94
sp|Q2QMH2|RHD31_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Oryza sativa subsp. japonica GN=Os12g0604600 PE=2 SV=1 29 749 4.0E-94
sp|C4LTM1|SEY11_ENTHI Protein SEY1 homolog 1 OS=Entamoeba histolytica GN=EHI_012280 PE=3 SV=1 34 733 1.0E-93
sp|B0E843|SEY11_ENTDS Protein SEY1 homolog 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_213660 PE=3 SV=1 34 733 1.0E-92
sp|Q9SSN0|RHD31_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Arabidopsis thaliana GN=At1g72960 PE=2 SV=2 42 734 2.0E-91
sp|P93042|RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana GN=RHD3 PE=1 SV=1 35 775 1.0E-90
sp|Q0JLS6|RHD3_ORYSJ Protein ROOT HAIR DEFECTIVE 3 OS=Oryza sativa subsp. japonica GN=RHD3 PE=2 SV=1 35 749 2.0E-90
sp|Q9FKE9|RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana GN=At5g45160 PE=2 SV=1 35 722 4.0E-82
sp|Q2R224|RHD32_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Oryza sativa subsp. japonica GN=Os11g0582300 PE=2 SV=1 55 725 3.0E-81
sp|A2FJ32|SEY13_TRIVA Protein SEY1 homolog 3 OS=Trichomonas vaginalis GN=TVAG_204380 PE=3 SV=1 35 721 6.0E-77
sp|Q4XZY3|SEY1_PLACH Protein SEY1 homolog OS=Plasmodium chabaudi GN=PC000321.02.0 PE=3 SV=1 29 414 5.0E-65
sp|B3LAJ9|SEY1_PLAKH Protein SEY1 homolog OS=Plasmodium knowlesi (strain H) GN=PKH_133110 PE=3 SV=1 33 406 6.0E-63
sp|Q388F1|SEY1_TRYB2 Protein SEY1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.61.2200 PE=3 SV=1 56 359 7.0E-63
sp|Q8ILT5|SEY1_PLAF7 Protein SEY1 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0159 PE=3 SV=2 30 409 4.0E-62
sp|A4HK17|SEY1_LEIBR Protein SEY1 homolog OS=Leishmania braziliensis GN=LbrM32_V2.0440 PE=3 SV=2 55 394 1.0E-61
sp|Q4Q5P8|SEY1_LEIMA Protein SEY1 homolog OS=Leishmania major GN=LmjF32.0370 PE=3 SV=2 56 394 3.0E-61
sp|A5K168|SEY1_PLAVS Protein SEY1 homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_085645 PE=3 SV=1 33 406 9.0E-61
sp|Q4DHA1|SEY1_TRYCC Protein SEY1 homolog OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511285.50 PE=3 SV=1 29 354 4.0E-60
sp|A4I7K1|SEY1_LEIIN Protein SEY1 homolog OS=Leishmania infantum GN=LinJ32.0740 PE=3 SV=2 55 394 6.0E-60
sp|A7AT07|SEY1_BABBO Protein SEY1 homolog OS=Babesia bovis GN=BBOV_II001090 PE=3 SV=1 60 395 4.0E-58
sp|Q4U9I8|SEY1_THEAN Protein SEY1 homolog OS=Theileria annulata GN=TA08650 PE=3 SV=1 1 735 5.0E-55
sp|A0BKG2|SEY11_PARTE Protein SEY1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00029660001 PE=3 SV=1 44 732 3.0E-53
sp|A0E2L1|SEY12_PARTE Protein SEY1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00022700001 PE=3 SV=1 55 732 5.0E-53
sp|Q4N280|SEY1_THEPA Protein SEY1 homolog OS=Theileria parva GN=TP04_0477 PE=3 SV=2 45 416 2.0E-51
sp|A8BW14|SEY1_GIAIC Protein SEY1 homolog OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_32509 PE=3 SV=1 63 426 6.0E-40
sp|Q5CL93|SEY1_CRYHO Protein SEY1 homolog OS=Cryptosporidium hominis GN=Chro.80282 PE=3 SV=1 35 341 1.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 705 727 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042130
MASNNFAATQPNGTAATAPVNGRTSHYNAATERLQIVDNEKHFTPDLTKQIERWGLRDTGFEYNIVAVFGSQSTG
KSTLLNRLFGTTFDVMDEAKRQQTTKGIWMCRGEGMNVMVMDVEGTDGRERGEDQDFERKSALFSLASSEVLIVN
MWEHQIGLYNGANMGLLKTVFEVNLGLFGKKENSSGRTLLLFVIRDHIGSTPLANLQATITTDLSRLWEGLSKPA
ELKDQQLSDYFDLEFTTLPHKLLVPDKFDAGVQSLRRRFVDKGSPDYLFKPAYHKWIPADGVAFYMEGIWEQVQS
NKDLDLPTQQELLAQFRCDEISAGALAEFNEQVKSQKRPIEAGQVVQGLGQMMKNWRTQALTRYDRDASRYHKAV
YNRKRSDLVAALDAVLSPLFLGQLKNLHKYCLVQFKKSLLDGLKGEEYDFGDVVVKGRAKWENKFKETAKEAVVE
GTDWVWEDEMELLREEIQGVADQCRKDETKKMVNQIERNIKKHIADPVELQLNKGTEDMWDEILRSFIGILSKAE
EAYLTKAKSFNCTEEENESSLTTLRKRAWQGLRAKVDEQTADAVFLSKLRGHFEERFRYDEQGVPRVWKPDDDID
GAFKKAKEATLDLIPRYADIKPQDSSLEFTLPSDSADSLSGEPELDFEASLVVFSPTKQMDLGNRFRKDADAYYV
EAKRSTVASIAQIPTWMYGLLLVLGWNEAMFILFNPLYFTLLLLAAASAYVVNQLGLAGPLMQVTKSVAGEVQNQ
AATKLREHLAPPTSPEPASSTPSRSSSMRDLYDEDEFRRRQQHEI*
Coding >AgabiH97|042130
ATGGCTTCAAATAACTTTGCTGCCACTCAACCAAATGGGACTGCTGCCACGGCTCCCGTCAACGGGCGTACATCC
CACTACAATGCAGCCACCGAACGTCTACAAATTGTTGACAACGAAAAACATTTCACTCCCGACTTGACCAAACAG
ATTGAACGGTGGGGACTTCGAGACACAGGTTTCGAGTACAACATCGTCGCTGTATTTGGCTCGCAGTCAACGGGG
AAAAGTACCCTACTAAATAGGTTGTTTGGAACAACCTTCGACGTCATGGACGAGGCCAAACGTCAACAGACAACT
AAGGGTATTTGGATGTGTCGAGGCGAGGGTATGAACGTAATGGTCATGGATGTAGAAGGTACCGATGGTCGTGAA
CGTGGCGAGGACCAAGATTTTGAGCGCAAATCTGCCTTATTCTCCCTTGCTTCGTCTGAAGTTCTCATTGTCAAC
ATGTGGGAGCATCAAATCGGTCTGTACAACGGTGCAAATATGGGTCTCCTCAAAACGGTATTCGAAGTGAATTTG
GGCCTGTTCGGAAAGAAAGAGAACTCCAGTGGCCGAACTCTACTTCTGTTTGTCATCCGCGACCACATTGGTTCA
ACGCCCCTCGCCAATCTCCAAGCCACCATTACTACTGACCTTTCGCGATTATGGGAAGGTCTTTCGAAGCCTGCT
GAGCTTAAAGACCAACAACTTTCCGATTATTTTGACCTCGAGTTCACAACTCTCCCGCACAAACTCCTGGTTCCT
GACAAGTTTGATGCCGGAGTTCAATCTCTTCGTAGACGCTTTGTGGACAAAGGGAGCCCAGATTATCTGTTCAAG
CCCGCCTACCACAAATGGATTCCTGCCGATGGCGTTGCTTTCTACATGGAGGGTATTTGGGAACAAGTTCAGTCA
AATAAGGACCTTGATCTGCCAACACAACAAGAGTTGCTTGCTCAATTCCGTTGTGATGAGATCTCAGCGGGCGCT
CTTGCGGAATTCAATGAGCAAGTAAAGTCCCAGAAACGACCTATTGAAGCTGGTCAGGTGGTTCAAGGCCTTGGT
CAGATGATGAAGAATTGGAGGACACAAGCTTTAACTCGCTACGATCGTGATGCCTCGAGATACCACAAGGCCGTA
TATAACCGTAAACGCTCAGACCTCGTAGCTGCCTTGGATGCGGTACTTTCTCCCCTTTTCCTCGGACAACTCAAA
AACCTCCACAAATATTGTCTCGTGCAGTTCAAGAAGAGTCTTCTTGATGGGCTTAAGGGTGAGGAATACGATTTC
GGTGATGTCGTCGTCAAGGGAAGGGCAAAGTGGGAAAACAAATTCAAGGAGACTGCAAAGGAGGCTGTCGTCGAA
GGTACAGATTGGGTGTGGGAAGACGAAATGGAACTTTTAAGAGAGGAAATCCAGGGTGTGGCTGATCAATGCAGG
AAAGACGAAACGAAGAAAATGGTTAATCAAATTGAGAGGAACATCAAGAAGCATATAGCAGACCCCGTTGAGCTG
CAACTTAACAAAGGAACCGAAGACATGTGGGACGAGATTCTTCGTTCATTCATTGGCATCCTTTCCAAAGCTGAG
GAAGCATACTTAACGAAGGCTAAAAGTTTCAACTGCACGGAGGAGGAAAATGAGTCTTCTCTCACCACCCTTCGT
AAACGTGCCTGGCAGGGCCTTCGGGCAAAAGTTGATGAACAAACTGCCGATGCTGTTTTCTTGAGCAAGCTTCGC
GGTCATTTTGAGGAGCGTTTCCGCTACGATGAGCAGGGTGTGCCCCGTGTTTGGAAACCCGATGACGACATTGAT
GGTGCTTTCAAGAAAGCGAAAGAGGCGACACTTGACCTCATTCCTCGTTATGCTGATATCAAGCCTCAGGATTCC
TCGCTAGAGTTTACCCTCCCTTCTGATTCAGCGGATTCTCTGAGTGGAGAGCCCGAATTGGACTTCGAAGCTTCC
CTCGTCGTGTTCTCTCCTACCAAACAAATGGATTTGGGTAACAGATTCCGCAAAGATGCTGATGCATACTACGTT
GAGGCAAAAAGAAGCACTGTTGCAAGCATTGCGCAGATCCCTACATGGATGTATGGTCTGCTTCTAGTGTTGGGT
TGGAATGAGGCTATGTTTATTTTGTTCAACCCTTTGTACTTCACGTTGTTGCTTTTGGCAGCAGCTTCAGCATAT
GTCGTCAATCAGCTCGGGTTAGCAGGACCCTTGATGCAGGTTACAAAATCAGTTGCTGGAGAGGTTCAAAACCAG
GCTGCAACAAAACTTCGAGAACATTTAGCGCCACCGACATCGCCTGAACCCGCTTCATCAACGCCGTCCCGATCA
AGTTCCATGCGTGATCTTTACGACGAAGATGAATTTAGACGGCGGCAGCAACATGAGATATGA
Transcript >AgabiH97|042130
ATGGCTTCAAATAACTTTGCTGCCACTCAACCAAATGGGACTGCTGCCACGGCTCCCGTCAACGGGCGTACATCC
CACTACAATGCAGCCACCGAACGTCTACAAATTGTTGACAACGAAAAACATTTCACTCCCGACTTGACCAAACAG
ATTGAACGGTGGGGACTTCGAGACACAGGTTTCGAGTACAACATCGTCGCTGTATTTGGCTCGCAGTCAACGGGG
AAAAGTACCCTACTAAATAGGTTGTTTGGAACAACCTTCGACGTCATGGACGAGGCCAAACGTCAACAGACAACT
AAGGGTATTTGGATGTGTCGAGGCGAGGGTATGAACGTAATGGTCATGGATGTAGAAGGTACCGATGGTCGTGAA
CGTGGCGAGGACCAAGATTTTGAGCGCAAATCTGCCTTATTCTCCCTTGCTTCGTCTGAAGTTCTCATTGTCAAC
ATGTGGGAGCATCAAATCGGTCTGTACAACGGTGCAAATATGGGTCTCCTCAAAACGGTATTCGAAGTGAATTTG
GGCCTGTTCGGAAAGAAAGAGAACTCCAGTGGCCGAACTCTACTTCTGTTTGTCATCCGCGACCACATTGGTTCA
ACGCCCCTCGCCAATCTCCAAGCCACCATTACTACTGACCTTTCGCGATTATGGGAAGGTCTTTCGAAGCCTGCT
GAGCTTAAAGACCAACAACTTTCCGATTATTTTGACCTCGAGTTCACAACTCTCCCGCACAAACTCCTGGTTCCT
GACAAGTTTGATGCCGGAGTTCAATCTCTTCGTAGACGCTTTGTGGACAAAGGGAGCCCAGATTATCTGTTCAAG
CCCGCCTACCACAAATGGATTCCTGCCGATGGCGTTGCTTTCTACATGGAGGGTATTTGGGAACAAGTTCAGTCA
AATAAGGACCTTGATCTGCCAACACAACAAGAGTTGCTTGCTCAATTCCGTTGTGATGAGATCTCAGCGGGCGCT
CTTGCGGAATTCAATGAGCAAGTAAAGTCCCAGAAACGACCTATTGAAGCTGGTCAGGTGGTTCAAGGCCTTGGT
CAGATGATGAAGAATTGGAGGACACAAGCTTTAACTCGCTACGATCGTGATGCCTCGAGATACCACAAGGCCGTA
TATAACCGTAAACGCTCAGACCTCGTAGCTGCCTTGGATGCGGTACTTTCTCCCCTTTTCCTCGGACAACTCAAA
AACCTCCACAAATATTGTCTCGTGCAGTTCAAGAAGAGTCTTCTTGATGGGCTTAAGGGTGAGGAATACGATTTC
GGTGATGTCGTCGTCAAGGGAAGGGCAAAGTGGGAAAACAAATTCAAGGAGACTGCAAAGGAGGCTGTCGTCGAA
GGTACAGATTGGGTGTGGGAAGACGAAATGGAACTTTTAAGAGAGGAAATCCAGGGTGTGGCTGATCAATGCAGG
AAAGACGAAACGAAGAAAATGGTTAATCAAATTGAGAGGAACATCAAGAAGCATATAGCAGACCCCGTTGAGCTG
CAACTTAACAAAGGAACCGAAGACATGTGGGACGAGATTCTTCGTTCATTCATTGGCATCCTTTCCAAAGCTGAG
GAAGCATACTTAACGAAGGCTAAAAGTTTCAACTGCACGGAGGAGGAAAATGAGTCTTCTCTCACCACCCTTCGT
AAACGTGCCTGGCAGGGCCTTCGGGCAAAAGTTGATGAACAAACTGCCGATGCTGTTTTCTTGAGCAAGCTTCGC
GGTCATTTTGAGGAGCGTTTCCGCTACGATGAGCAGGGTGTGCCCCGTGTTTGGAAACCCGATGACGACATTGAT
GGTGCTTTCAAGAAAGCGAAAGAGGCGACACTTGACCTCATTCCTCGTTATGCTGATATCAAGCCTCAGGATTCC
TCGCTAGAGTTTACCCTCCCTTCTGATTCAGCGGATTCTCTGAGTGGAGAGCCCGAATTGGACTTCGAAGCTTCC
CTCGTCGTGTTCTCTCCTACCAAACAAATGGATTTGGGTAACAGATTCCGCAAAGATGCTGATGCATACTACGTT
GAGGCAAAAAGAAGCACTGTTGCAAGCATTGCGCAGATCCCTACATGGATGTATGGTCTGCTTCTAGTGTTGGGT
TGGAATGAGGCTATGTTTATTTTGTTCAACCCTTTGTACTTCACGTTGTTGCTTTTGGCAGCAGCTTCAGCATAT
GTCGTCAATCAGCTCGGGTTAGCAGGACCCTTGATGCAGGTTACAAAATCAGTTGCTGGAGAGGTTCAAAACCAG
GCTGCAACAAAACTTCGAGAACATTTAGCGCCACCGACATCGCCTGAACCCGCTTCATCAACGCCGTCCCGATCA
AGTTCCATGCGTGATCTTTACGACGAAGATGAATTTAGACGGCGGCAGCAACATGAGATATGA
Gene >AgabiH97|042130
ATGGCTTCAAATAACTTTGCTGCCACTCAACCAAATGGGACTGCTGCCACGGCTCCCGTCAACGGGCGTACATCC
CACTACAATGCAGCCACCGAACGTCTACAAATTGTTGACAACGAAAAACATTTCACGTATGCTTTCCCGCCTCGT
CCTACTATGAATTCTAATGCCTACCTCCATAGTCCCGACTTGACCAAACAGATTGAACGGTGGGGACTTCGAGAC
ACAGGTTTCGAGTACAACATCGTCGCTGTATTTGGCTCGCAGTCAACGGGGAAAAGTGAGCTACCTGAATTTTTT
TTTGTCTTTTGACGAGAATGCTTGCTGAGATCCTGCAAAGGTACCCTACTAAATAGGTTGTTTGGAACAACCTTC
GACGTCATGGACGAGGCCAAACGTCAACAGACAACTAAGGGTATGTCGATTCCCGGATCATATGGCACCCTTCCT
AAGACTTGCTGCAATAGGTATTTGGATGTGTCGAGGCGAGGGTATGAACGTAATGGTCATGGATGTAGAAGGTAC
CGATGGTCGTGAACGTGGCGAGGACCAAGATTTTGAGCGCAAATCTGCCTTATTCTCCCTTGCTTCGTCTGAAGT
TCTCATTGTCAACATGTGGGAGCATCAAATCGGTCTGTACAACGGTGCAAATATGGGTCTCCTCAAAACGGTATT
CGAAGTGAATTTGGGCCTGTTCGGAAAGAAAGAGAAGTACGGTTCTACGAAGTTGACGACCAATTAATGCGTTGG
CTAATGTTCCATCAGCTCCAGTGGCCGAACTCTACTTCTGTTTGTCATCCGCGACCACATTGGTTCAACGCCCCT
CGCCAATCTCCAAGCCACCATTACTACTGACCTTTCGCGATTATGGGAAGGTCTTTCGAAGCCTGCTGAGCTTAA
AGACCAACAACTTTCCGATTATTTTGACCTCGAGTTCACAACTCTCCCGCACAAACTCCTGGTTCCTGACAAGTT
TGATGCCGGAGTTCAATCTCTTCGTAGACGCTTTGTGGACAAAGGGAGCCCAGATTATCTGTTCAAGCCCGCCTA
CCACAAATGGATTCCTGCCGATGGCGTTGCTTTCTACATGGAGGGTATTTGGGTGAGTGTGCTTAATGACGCTGT
CGTTTGGGTTATAGATTGATGTCGCGGATTCCAGGAACAAGTTCAGTCAAATAAGGACCTTGATCTGCCAACACA
ACAAGAGTTGCTTGCTCAATTCCGTTGTGATGAGATCTCAGCGGGCGCTCTTGCGGAATTCAATGAGCAAGTAAA
GTCCCAGAAACGACCTATTGAAGCTGGTCAGGTGGTTCAAGGCCTTGGTCAGATGATGAAGAATTGGAGGACACA
AGCTTTAAGTAAGTTATTTTATATCATTGACCTCATGAGCATTAATTTAATGCGCTAATAAAGCTCGCTACGATC
GTGATGCCTCGAGATACCACAAGGCCGTATATAACCGTAAACGCTCAGACCTCGTAGCTGCCTTGGATGCGGTAC
TTTCTCCCCTTTTCCTCGGACAACTCAAAAACCTCCACAAATATTGTCTCGTGCAGTTCAAGAAGAGTCTTCTTG
ATGGGCTTAAGGGTGAGGAATACGATTTCGGTGATGTCGTCGTCAAGGGAAGGGCAAAGTGGGAAAACAAATTCA
AGGAGACTGCAAAGGAGGCTGTCGTCGAAGGTACAGATTGGGTGTGGGAAGACGAAATGGAACTTTTAAGAGAGG
AAATCCAGGGTGTGGCTGATCAATGCAGGAAAGACGAAACGAAGAAAATGGTTAATCAAATTGAGGTTTGTTTCT
TGCAACGGATAATATGGTTGCAAAGGATTAATCAGCGTCACAGAGGAACATCAAGAAGCATATAGCAGACCCCGT
TGAGCTGCAACTTAACAAAGGAACCGAAGACATGTGGGACGAGATTCTTCGTTCATTCATTGGCATCCTTTCCAA
AGCTGAGGAAGCATACTTAACGAAGGCTAAAAGTGGGTGACTGTCTGCTATTTTGGTTCTTTTCTGTAATATCAT
AATAGGTTTCAACTGCACGGAGGAGGAAAATGAGTCTTCTCTCACCACCCTTCGTAAACGTGCCTGGCAGGGCCT
TCGGGCAAAAGTTGATGAACAAACTGCCGATGCTGTTTTCTTGAGCAAGCTTCGCGGTCATTTTGAGGAGCGTTT
CCGCTACGATGAGCAGGGTGTGCCCCGTGTTTGGAAACCCGATGACGACATTGATGGTGCTTTCAAGAAAGCGAA
AGAGGCGGTAGGCACTTTTTCCTGCTTCTGCAACTCTCTGACTCACGACCATGCTTGACAATAGACACTTGACCT
CATTCCTCGTTATGCTGATATCAAGCCTCAGGATTCCTCGCTAGAGTTTACCCTCCCTTCTGATTCAGCGGATTC
TCTGAGTGGAGAGCCCGAATTGGACTTCGAAGCTTCCCTCGTCGTGTTCTCTCCTACCAAACAAATGGATTTGGG
TAACAGATTCCGCAAAGATGCTGATGCATACTACGTTGAGGCAAAAAGAAGCACTGTTGCAAGCATTGCGCAGAT
CCCTACATGGATGTATGGTCTGCTTCTAGTGTTGGGTTGGAATGAGGCTATGTTTATTTTGTTCAACCCTTTGTA
CTTCACGTTGTTGCTTTTGGCAGCAGCTTCAGCATATGTCGTCAATCAGCTCGGGTTAGCAGGACCCTTGATGCA
GGTTACAAAATCAGTTGCTGGAGAGGTGAGAGGACTTTTTCTGTTGAGTTTTGTTTTTGGACTAACTACGTTGTA
GGTTCAAAACCAGGCTGCAACAAAACTTCGAGAACATTTAGCGCCACCGACATCGCCTGAACCCGCTTCATCAAC
GCCGTCCCGATCAAGTTCCATGCGTGATCTTTACGACGAAGATGAATTTAGACGGCGGCAGCAACATGAGATATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail