Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|042030
Gene name
Locationscaffold_2:890183..892052
Strand+
Gene length (bp)1869
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 2.2E-13 31 289
PF09273 Rubis-subs-bind Rubisco LSMT substrate-binding 5.1E-11 343 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 4 459 6.0E-30
sp|Q9CWY3|SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus GN=Setd6 PE=1 SV=1 4 456 4.0E-29
sp|Q803K4|SETD6_DANRE N-lysine methyltransferase setd6 OS=Danio rerio GN=setd6 PE=2 SV=1 33 459 3.0E-27
sp|E1BI64|SETD6_BOVIN N-lysine methyltransferase SETD6 OS=Bos taurus GN=SETD6 PE=2 SV=1 1 456 7.0E-26
sp|Q9P6L2|RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set13 PE=3 SV=2 3 459 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 4 459 6.0E-30
sp|Q9CWY3|SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus GN=Setd6 PE=1 SV=1 4 456 4.0E-29
sp|Q803K4|SETD6_DANRE N-lysine methyltransferase setd6 OS=Danio rerio GN=setd6 PE=2 SV=1 33 459 3.0E-27
sp|E1BI64|SETD6_BOVIN N-lysine methyltransferase SETD6 OS=Bos taurus GN=SETD6 PE=2 SV=1 1 456 7.0E-26
sp|Q9P6L2|RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set13 PE=3 SV=2 3 459 2.0E-24
sp|D3ZSK5|SETD6_RAT N-lysine methyltransferase SETD6 OS=Rattus norvegicus GN=Setd6 PE=3 SV=1 4 456 3.0E-24
sp|A4QNG5|SETD6_XENTR N-lysine methyltransferase setd6 OS=Xenopus tropicalis GN=setd6 PE=2 SV=1 1 459 8.0E-24
sp|Q12504|RKM4_YEAST Ribosomal lysine N-methyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKM4 PE=1 SV=1 4 380 1.0E-23
sp|C0H8I2|SETD6_SALSA N-lysine methyltransferase setd6 OS=Salmo salar GN=setd6 PE=2 SV=1 1 459 2.0E-22
sp|Q6INM2|SETD6_XENLA N-lysine methyltransferase setd6 OS=Xenopus laevis GN=setd6 PE=2 SV=1 4 459 3.0E-22
sp|Q8TBK2|SETD6_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens GN=SETD6 PE=1 SV=2 30 456 4.0E-21
sp|P94026|RBCMT_TOBAC Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic OS=Nicotiana tabacum GN=RBCMT PE=2 SV=1 3 454 7.0E-09
sp|Q43088|RBCMT_PEA Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic OS=Pisum sativum GN=RBCMT PE=1 SV=1 3 454 3.0E-08
sp|Q9XI84|RBCMT_ARATH [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=LSMT-L PE=1 SV=1 3 181 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|042030
MGTFIQWFQRKGAYFDAESVGIIGFPPSEGGRGAVALRDIPNGHTLFSIPRTLTISTRTCSLPTKFGLEAWRKAQ
LHQGWVGLILCLMWETAAGSSSKWAGYLDILPNRFDTPMFWTEYDLLELKGTSVVEKLGKVDAQADYNEKLLPAV
KSRPDLFLPEHLSTHYTLERYHIMGSRILSRSFIVEKWNEDEDENEAANTSLGSAMDVEPSRNEETPGVPMETED
NSDDNDDDDDDDEEASDVAMVPMADILNARYQTENAKLFHEKDELKMVTTKPIRSGEQIWNTYGDLPNAELLRRY
GHVDFLSLPSEGHGNPGDVVEIKADLIISAVSSIPEAVKDDEAKERIDWWLEEGGEDIFILDYEYDLPPVMISFV
KLLLLPQADWEKAREKSKPPKSKLEGILYDILISTLEKRLAEYPTTIETDKALLTNDTPLNKKNAIIVRLGEKEI
LHGILQKLKVLKEAEGRSSAGASTKRKGGASGPTKVKRIRR*
Coding >AgabiH97|042030
ATGGGGACCTTCATCCAATGGTTTCAACGTAAAGGTGCATATTTTGACGCCGAATCCGTGGGCATCATTGGATTT
CCCCCTTCTGAGGGTGGTCGTGGTGCCGTTGCACTGAGAGATATTCCAAATGGACATACACTTTTCTCAATTCCT
AGAACCCTAACAATTTCCACACGTACATGTAGTCTCCCCACAAAATTTGGTCTCGAAGCTTGGCGAAAAGCCCAA
CTCCATCAAGGGTGGGTCGGTCTGATTTTGTGTTTGATGTGGGAGACTGCGGCTGGGTCGTCTTCCAAGTGGGCG
GGTTATTTAGATATTTTGCCGAACCGTTTCGATACACCTATGTTCTGGACTGAATACGACCTCCTAGAATTAAAA
GGTACCTCTGTGGTAGAAAAACTCGGCAAGGTAGATGCACAAGCAGACTACAACGAGAAACTTTTACCAGCGGTC
AAATCAAGACCAGACTTGTTTCTTCCTGAACATCTATCAACACATTATACCCTCGAGAGGTATCATATCATGGGT
AGTCGTATCCTTTCACGAAGTTTTATTGTGGAAAAGTGGAATGAAGACGAAGATGAAAACGAAGCTGCCAATACA
AGTCTAGGCAGTGCTATGGATGTCGAGCCAAGTCGCAATGAAGAAACACCAGGCGTTCCAATGGAAACTGAGGAC
AATTCGGACGACAATGACGACGACGACGATGATGATGAAGAGGCTTCCGATGTGGCCATGGTACCAATGGCTGAT
ATACTGAATGCAAGATATCAGACAGAAAATGCAAAACTGTTTCACGAAAAGGACGAGCTAAAGATGGTGACCACA
AAGCCGATCAGAAGTGGCGAACAAATTTGGAATACCTACGGCGATCTACCAAACGCAGAGCTGCTGCGGCGATAT
GGGCACGTCGATTTTCTATCTCTTCCTTCTGAAGGTCATGGGAATCCCGGAGATGTCGTTGAAATCAAGGCCGAT
CTCATTATATCCGCAGTATCGTCAATACCAGAAGCTGTCAAGGATGACGAAGCAAAGGAAAGGATCGATTGGTGG
CTAGAAGAGGGTGGTGAAGATATCTTCATTCTGGACTACGAATATGATTTGCCACCGGTCATGATCTCGTTTGTA
AAACTCCTGCTTCTGCCCCAAGCTGATTGGGAGAAAGCTCGAGAAAAGTCAAAACCACCCAAGTCAAAGCTCGAG
GGTATTCTGTATGACATCTTGATCTCGACTCTTGAAAAACGCTTGGCCGAGTACCCTACCACAATAGAGACGGAT
AAGGCACTTTTGACGAACGACACCCCTTTGAATAAGAAGAATGCCATCATCGTCCGCCTTGGTGAAAAAGAGATT
TTACATGGAATCTTGCAAAAATTAAAAGTTCTGAAAGAGGCTGAGGGTAGAAGCAGTGCTGGAGCGTCCACAAAA
AGAAAAGGTGGGGCGAGCGGCCCCACCAAGGTGAAAAGGATAAGGCGATGA
Transcript >AgabiH97|042030
ATGGGGACCTTCATCCAATGGTTTCAACGTAAAGGTGCATATTTTGACGCCGAATCCGTGGGCATCATTGGATTT
CCCCCTTCTGAGGGTGGTCGTGGTGCCGTTGCACTGAGAGATATTCCAAATGGACATACACTTTTCTCAATTCCT
AGAACCCTAACAATTTCCACACGTACATGTAGTCTCCCCACAAAATTTGGTCTCGAAGCTTGGCGAAAAGCCCAA
CTCCATCAAGGGTGGGTCGGTCTGATTTTGTGTTTGATGTGGGAGACTGCGGCTGGGTCGTCTTCCAAGTGGGCG
GGTTATTTAGATATTTTGCCGAACCGTTTCGATACACCTATGTTCTGGACTGAATACGACCTCCTAGAATTAAAA
GGTACCTCTGTGGTAGAAAAACTCGGCAAGGTAGATGCACAAGCAGACTACAACGAGAAACTTTTACCAGCGGTC
AAATCAAGACCAGACTTGTTTCTTCCTGAACATCTATCAACACATTATACCCTCGAGAGGTATCATATCATGGGT
AGTCGTATCCTTTCACGAAGTTTTATTGTGGAAAAGTGGAATGAAGACGAAGATGAAAACGAAGCTGCCAATACA
AGTCTAGGCAGTGCTATGGATGTCGAGCCAAGTCGCAATGAAGAAACACCAGGCGTTCCAATGGAAACTGAGGAC
AATTCGGACGACAATGACGACGACGACGATGATGATGAAGAGGCTTCCGATGTGGCCATGGTACCAATGGCTGAT
ATACTGAATGCAAGATATCAGACAGAAAATGCAAAACTGTTTCACGAAAAGGACGAGCTAAAGATGGTGACCACA
AAGCCGATCAGAAGTGGCGAACAAATTTGGAATACCTACGGCGATCTACCAAACGCAGAGCTGCTGCGGCGATAT
GGGCACGTCGATTTTCTATCTCTTCCTTCTGAAGGTCATGGGAATCCCGGAGATGTCGTTGAAATCAAGGCCGAT
CTCATTATATCCGCAGTATCGTCAATACCAGAAGCTGTCAAGGATGACGAAGCAAAGGAAAGGATCGATTGGTGG
CTAGAAGAGGGTGGTGAAGATATCTTCATTCTGGACTACGAATATGATTTGCCACCGGTCATGATCTCGTTTGTA
AAACTCCTGCTTCTGCCCCAAGCTGATTGGGAGAAAGCTCGAGAAAAGTCAAAACCACCCAAGTCAAAGCTCGAG
GGTATTCTGTATGACATCTTGATCTCGACTCTTGAAAAACGCTTGGCCGAGTACCCTACCACAATAGAGACGGAT
AAGGCACTTTTGACGAACGACACCCCTTTGAATAAGAAGAATGCCATCATCGTCCGCCTTGGTGAAAAAGAGATT
TTACATGGAATCTTGCAAAAATTAAAAGTTCTGAAAGAGGCTGAGGGTAGAAGCAGTGCTGGAGCGTCCACAAAA
AGAAAAGGTGGGGCGAGCGGCCCCACCAAGGTGAAAAGGATAAGGCGATGA
Gene >AgabiH97|042030
ATGGGGACCTTCATCCAATGGTTTCAACGTAAAGGTGCATATTTTGACGCCGAATCCGTGGGCATCATTGGATTT
CCCCCTTCTGAGGGTGGTCGTGGTGCCGTTGCACTGAGAGATATTCCAGTGCGTGATTAATCATTTCTCAATAAA
TTCGAATTAAGAATTCTCAGAATGGACATACACTTTTCTCAATTCCTAGAACCCTAACAATTTCCACACGTACAT
GTAGTCTCCCCACAAAATTTGGTCTCGAAGCTTGGCGAAAAGCCCAACTCCATCAAGGGTGGGTCGGTCTGATTT
TGTGTTTGATGTGGGAGACTGCGGCTGGGTCGTCTTCCAAGTGGGCGGGTTATTTAGGTATGTCTCGCCATCTAT
GTAATAACTCGCCGGCCAAGTAACTTATATATAAAAACTGATAGATATTTTGCCGAACCGTTTCGATACACCTAT
GTTCTGGACTGAATACGACCTCCTAGAATTAAAAGGTACCTCTGTGGTAGGTCGGTTTGTTCAAAAATTTCGACG
AGTAAATGAGTATAGTCTTACCTTCATCTGCAGAAAAACTCGGCAAGGTAGATGCACAAGCAGACTACAACGAGA
AACTTTTACCAGCGGTCAAATCAAGACCAGACTTGTTTCTTCCTGAACATCTATCAACACATTATACCCTCGAGA
GGTATCATATCATGGGTAGTCGTATCCTTTCACGAAGTTTTATTGTGGAAAAGTGGAATGAAGACGAAGATGAAA
ACGAAGCTGCCAATACAAGTCTAGGCAGTGCTATGGATGTCGAGCCAAGTCGCAATGAAGAAACACCAGGCGTTC
CAATGGAAACTGAGGACAATTCGGACGACAATGACGACGACGACGATGATGATGAAGAGGCTTCCGATGTGGCCA
TGGTACCAATGGCTGATATACTGAATGCAAGATATCAGACAGAAAATGTCAGTGGTTGACGTTCATGGCACGGAC
GGATGAGAATTCAATTTGTCTCTACCAGGCAAAACTGTTTCACGAAAAGGACGAGCTAAAGATGGTGACCACAAA
GCCGATCAGAAGTGGCGAACAAATTGTCAGTTTTTCCGTAATCAATCGCTTGTGTGCTGCCATTCTAACTTTTTC
TCAATTAAGTGGAATACCTACGGCGATCTACCAAACGCAGAGCTGCTGCGGCGATATGGGCACGTCGATTTTCTA
TCTCTTCCTTCTGAAGGTCATGGGAATCCCGGAGATGTCGTTGAAATCAAGGCCGATCTCATTATATCCGCAGTA
TCGTCAATACCAGAAGCTGTCAAGGATGACGAAGCAAAGGAAAGGATCGATTGGTGGCTAGAAGAGGGTGGTGAA
GAGTAAGTGTTGCAAATATTGATTTTGTTCTCGAATCGTGATTCTGATTTTTTTGGTCTTGTAGTATCTTCATTC
TGGACTACGAATATGATTTGCCACCGGTCATGATCTCGTTTGTAAAACTCCTGCTTCTGCCCCAAGCTGATTGGG
AGAAAGCTCGAGAAAAGTCAAAACCACCCAAGTCAAAGCTCGAGGGTATTCTGTATGACATCTTGATCTCGACTC
TTGAAAAACGCTTGGCCGAGTACCCTACCACAATAGAGGTAACAATAGTACACTCCCTTTTCTCCGAGACTAATC
GCACCATCTTAGACGGATAAGGCACTTTTGACGAACGACACCCCTTTGAATAAGAAGAATGCCATCATCGTCCGC
CTTGGTGAAAAAGAGATTTTACATGGAATCTTGCAAAAATTAAAAGTTCTGAAAGAGGCTGAGGGTAGAAGCAGT
GCTGGAGCGTCCACAAAAAGAAAAGGTGGGGCGAGCGGCCCCACCAAGGTGAAAAGGATAAGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail