Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041940
Gene name
Locationscaffold_2:866445..869405
Strand+
Gene length (bp)2960
Transcript length (bp)2313
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain 6.0E-127 32 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53852|SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL247W PE=1 SV=1 3 762 0.0E+00
sp|Q09860|SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29E6.06c PE=3 SV=1 1 764 0.0E+00
sp|Q4R550|SYCC_MACFA Cysteine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=CARS PE=2 SV=1 3 763 0.0E+00
sp|Q7ZWR2|SYCC_XENLA Cysteine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=cars PE=2 SV=1 3 763 0.0E+00
sp|Q9ER72|SYCC_MOUSE Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 3 763 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53852|SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL247W PE=1 SV=1 3 762 0.0E+00
sp|Q09860|SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29E6.06c PE=3 SV=1 1 764 0.0E+00
sp|Q4R550|SYCC_MACFA Cysteine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=CARS PE=2 SV=1 3 763 0.0E+00
sp|Q7ZWR2|SYCC_XENLA Cysteine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=cars PE=2 SV=1 3 763 0.0E+00
sp|Q9ER72|SYCC_MOUSE Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 3 763 0.0E+00
sp|Q5F408|SYCC_CHICK Cysteine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=CARS PE=2 SV=1 3 763 0.0E+00
sp|Q5M7N8|SYCC_XENTR Cysteine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=cars PE=2 SV=1 3 763 0.0E+00
sp|P49589|SYCC_HUMAN Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3 3 763 0.0E+00
sp|Q291L4|SYCC_DROPS Cysteine--tRNA ligase, cytoplasmic OS=Drosophila pseudoobscura pseudoobscura GN=Aats-cys PE=3 SV=1 3 762 0.0E+00
sp|Q7KN90|SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-cys PE=1 SV=1 4 741 6.0E-178
sp|Q54KR1|SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=cysS PE=3 SV=1 233 763 2.0E-134
sp|Q8SRE0|SYC_ENCCU Cysteine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0490 PE=1 SV=1 241 664 9.0E-80
sp|Q8BYM8|SYCM_MOUSE Probable cysteine--tRNA ligase, mitochondrial OS=Mus musculus GN=Cars2 PE=1 SV=2 236 668 5.0E-72
sp|Q2KIF8|SYCM_BOVIN Cysteine--tRNA ligase, mitochondrial OS=Bos taurus GN=CARS2 PE=2 SV=1 236 675 2.0E-70
sp|Q6DJ95|SYCM_XENTR Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=cars2 PE=2 SV=1 232 629 1.0E-69
sp|Q9UYV2|SYC_PYRAB Cysteine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysS PE=3 SV=1 174 551 4.0E-69
sp|O58370|SYC_PYRHO Cysteine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cysS PE=3 SV=1 174 577 5.0E-69
sp|C5A739|SYC_THEGJ Cysteine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=cysS PE=3 SV=1 174 552 5.0E-68
sp|B6YUQ3|SYC_THEON Cysteine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=cysS PE=3 SV=1 174 659 6.0E-68
sp|Q5JD45|SYC_THEKO Cysteine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cysS PE=3 SV=1 174 659 8.0E-68
sp|Q9HA77|SYCM_HUMAN Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens GN=CARS2 PE=1 SV=1 220 656 2.0E-67
sp|B2TIF6|SYC_CLOBB Cysteine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=cysS PE=3 SV=1 235 659 9.0E-66
sp|Q8U227|SYC_PYRFU Cysteine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cysS PE=3 SV=2 174 556 3.0E-65
sp|A6UP68|SYC_METVS Cysteine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=cysS PE=3 SV=1 174 666 2.0E-64
sp|Q6PA41|SYCM_XENLA Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=cars2 PE=2 SV=1 209 630 4.0E-64
sp|B2UY90|SYC_CLOBA Cysteine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=cysS PE=3 SV=1 235 659 5.0E-64
sp|A6VG07|SYC_METM7 Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=cysS PE=3 SV=1 235 552 8.0E-63
sp|Q6LYD1|SYC_METMP Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=cysS PE=3 SV=1 207 552 4.0E-62
sp|Q890M4|SYC_CLOTE Cysteine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=cysS PE=3 SV=1 220 629 7.0E-62
sp|A0PXS5|SYC_CLONN Cysteine--tRNA ligase OS=Clostridium novyi (strain NT) GN=cysS PE=3 SV=1 220 574 4.0E-61
sp|Q97ED6|SYC_CLOAB Cysteine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysS PE=3 SV=1 220 659 5.0E-61
sp|A9AAN8|SYC_METM6 Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=cysS PE=3 SV=1 235 552 5.0E-61
sp|Q3K3G5|SYC_STRA1 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=cysS PE=3 SV=1 234 659 5.0E-60
sp|Q8XHQ5|SYC_CLOPE Cysteine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=cysS PE=3 SV=1 235 659 8.0E-60
sp|Q0SQC1|SYC_CLOPS Cysteine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=cysS PE=3 SV=1 235 659 8.0E-60
sp|Q8E7F2|SYC_STRA3 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cysS PE=3 SV=1 234 659 2.0E-59
sp|Q8R7T3|SYC_CALS4 Cysteine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cysS PE=3 SV=1 183 580 2.0E-59
sp|A6TWK5|SYC_ALKMQ Cysteine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=cysS PE=3 SV=1 234 551 3.0E-59
sp|Q8E1Z4|SYC_STRA5 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=cysS PE=3 SV=1 234 659 3.0E-59
sp|Q0TMM4|SYC_CLOP1 Cysteine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=cysS PE=3 SV=1 235 659 3.0E-59
sp|B1HNM3|SYC_LYSSC Cysteine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=cysS PE=3 SV=1 245 552 4.0E-59
sp|Q54ZY3|SYCM_DICDI Probable cysteine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mcysS PE=3 SV=1 237 642 9.0E-59
sp|A7GK01|SYC_BACCN Cysteine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cysS PE=3 SV=1 236 659 1.0E-58
sp|C0QRE6|SYC_PERMH Cysteine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=cysS PE=3 SV=1 174 549 1.0E-58
sp|O67163|SYC_AQUAE Cysteine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=cysS PE=3 SV=1 174 659 2.0E-58
sp|A6UWT0|SYC_META3 Cysteine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=cysS PE=3 SV=1 235 578 2.0E-58
sp|Q97S25|SYC_STRPN Cysteine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cysS PE=3 SV=1 235 481 2.0E-58
sp|B1GYT2|SYC_UNCTG Cysteine--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=cysS PE=3 SV=1 202 543 2.0E-58
sp|Q8DQS8|SYC_STRR6 Cysteine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cysS PE=3 SV=1 235 481 2.0E-58
sp|C1ET19|SYC_BACC3 Cysteine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=cysS PE=3 SV=1 236 659 5.0E-58
sp|A4IJG8|SYC_GEOTN Cysteine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysS PE=3 SV=1 236 659 5.0E-58
sp|Q6HPS8|SYC_BACHK Cysteine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|Q63HB0|SYC_BACCZ Cysteine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|B7JK97|SYC_BACC0 Cysteine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|Q81VV1|SYC_BACAN Cysteine--tRNA ligase OS=Bacillus anthracis GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|C3LJ62|SYC_BACAC Cysteine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|C3P9N5|SYC_BACAA Cysteine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=cysS PE=3 SV=1 236 659 6.0E-58
sp|A0R8G1|SYC_BACAH Cysteine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=cysS PE=3 SV=1 236 659 1.0E-57
sp|Q73FB7|SYC_BACC1 Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysS PE=3 SV=1 236 659 1.0E-57
sp|Q39ZL8|SYC_GEOMG Cysteine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cysS PE=3 SV=1 236 577 1.0E-57
sp|C4KZR7|SYC_EXISA Cysteine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=cysS PE=3 SV=1 234 630 2.0E-57
sp|B9IZH4|SYC_BACCQ Cysteine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=cysS PE=3 SV=1 236 659 2.0E-57
sp|B7HQS4|SYC_BACC7 Cysteine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=cysS PE=3 SV=1 236 659 2.0E-57
sp|B2V6B4|SYC_SULSY Cysteine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=cysS PE=3 SV=1 174 561 2.0E-57
sp|Q8DWA9|SYC_STRMU Cysteine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cysS PE=3 SV=1 207 659 3.0E-57
sp|B6EH43|SYC_ALISL Cysteine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=cysS PE=3 SV=1 248 659 4.0E-57
sp|Q8YAB1|SYC_LISMO Cysteine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cysS PE=3 SV=1 218 586 5.0E-57
sp|Q3A8C9|SYC_PELCD Cysteine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=cysS PE=3 SV=1 234 555 5.0E-57
sp|A9VNA2|SYC_BACWK Cysteine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=cysS PE=3 SV=1 236 659 6.0E-57
sp|B8DF15|SYC_LISMH Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cysS PE=3 SV=1 245 586 7.0E-57
sp|Q724H3|SYC_LISMF Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cysS PE=3 SV=1 245 586 7.0E-57
sp|C1KYH2|SYC_LISMC Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cysS PE=3 SV=1 245 586 7.0E-57
sp|A6LPP1|SYC_CLOB8 Cysteine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=cysS PE=3 SV=1 220 544 8.0E-57
sp|Q06752|SYC_BACSU Cysteine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=cysS PE=1 SV=1 245 630 8.0E-57
sp|A4J0Y9|SYC_DESRM Cysteine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=cysS PE=3 SV=1 202 659 1.0E-56
sp|Q67JP9|SYC_SYMTH Cysteine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cysS PE=3 SV=1 237 575 1.0E-56
sp|C6E7P0|SYC_GEOSM Cysteine--tRNA ligase OS=Geobacter sp. (strain M21) GN=cysS PE=3 SV=1 213 579 2.0E-56
sp|Q5M6F6|SYC_STRT2 Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cysS PE=3 SV=1 234 659 2.0E-56
sp|Q5M1W6|SYC_STRT1 Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cysS PE=3 SV=1 234 659 2.0E-56
sp|A1AK01|SYC_PELPD Cysteine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=cysS PE=3 SV=1 245 577 2.0E-56
sp|Q8RIK9|SYC_FUSNN Cysteine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cysS PE=3 SV=1 220 548 2.0E-56
sp|A0LIR9|SYC_SYNFM Cysteine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=cysS PE=3 SV=1 202 594 2.0E-56
sp|C0ZIF7|SYC_BREBN Cysteine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysS PE=3 SV=1 235 659 2.0E-56
sp|Q81J59|SYC_BACCR Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysS PE=3 SV=1 236 579 2.0E-56
sp|B7HJ28|SYC_BACC4 Cysteine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=cysS PE=3 SV=1 236 579 2.0E-56
sp|B5EEK6|SYC_GEOBB Cysteine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=cysS PE=3 SV=1 244 579 3.0E-56
sp|F4IPY2|SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYCO PE=2 SV=1 202 554 3.0E-56
sp|A5G949|SYC_GEOUR Cysteine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=cysS PE=3 SV=1 244 583 3.0E-56
sp|Q65PC8|SYC_BACLD Cysteine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysS PE=3 SV=1 245 564 4.0E-56
sp|Q747A2|SYC_GEOSL Cysteine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=cysS PE=3 SV=1 243 548 4.0E-56
sp|A5N4M6|SYC_CLOK5 Cysteine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysS PE=3 SV=1 220 659 4.0E-56
sp|B9DY88|SYC_CLOK1 Cysteine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=cysS PE=3 SV=1 220 659 4.0E-56
sp|A0AF38|SYC_LISW6 Cysteine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cysS PE=3 SV=1 245 586 5.0E-56
sp|B7ISZ9|SYC_BACC2 Cysteine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=cysS PE=3 SV=1 236 579 5.0E-56
sp|B9MMM6|SYC_CALBD Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 237 556 8.0E-56
sp|Q92F36|SYC_LISIN Cysteine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cysS PE=3 SV=1 245 586 9.0E-56
sp|Q8KAK2|SYC_CHLTE Cysteine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=cysS PE=3 SV=1 237 555 1.0E-55
sp|B0TC35|SYC_HELMI Cysteine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=cysS PE=3 SV=1 236 553 1.0E-55
sp|Q8CTU1|SYC_STAES Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysS PE=3 SV=1 214 551 2.0E-55
sp|Q5HRM3|SYC_STAEQ Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysS PE=3 SV=1 214 551 2.0E-55
sp|A3DLW5|SYC_STAMF Cysteine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=cysS PE=3 SV=1 235 568 2.0E-55
sp|B0K5F6|SYC_THEPX Cysteine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=cysS PE=3 SV=1 183 579 3.0E-55
sp|B0KCH9|SYC_THEP3 Cysteine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=cysS PE=3 SV=1 183 579 3.0E-55
sp|C5D3P6|SYC_GEOSW Cysteine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=cysS PE=3 SV=1 236 579 3.0E-55
sp|A4XHE2|SYC_CALS8 Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 237 556 3.0E-55
sp|Q04DQ8|SYC_OENOB Cysteine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=cysS PE=3 SV=1 215 579 3.0E-55
sp|B0TLV2|SYC_SHEHH Cysteine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysS PE=3 SV=1 236 628 3.0E-55
sp|Q3A9P1|SYC_CARHZ Cysteine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=cysS PE=3 SV=1 237 553 3.0E-55
sp|Q87QJ9|SYC_VIBPA Cysteine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysS PE=3 SV=1 248 548 4.0E-55
sp|C3KVS3|SYC_CLOB6 Cysteine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=cysS PE=3 SV=1 235 574 5.0E-55
sp|Q5E4F1|SYC_VIBF1 Cysteine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysS PE=3 SV=1 248 579 6.0E-55
sp|Q4L3I9|SYC_STAHJ Cysteine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysS PE=3 SV=1 214 551 8.0E-55
sp|B7VGZ1|SYC_VIBTL Cysteine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=cysS PE=3 SV=1 248 548 9.0E-55
sp|C1FMX3|SYC_CLOBJ Cysteine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=cysS PE=3 SV=1 235 574 1.0E-54
sp|B1IGH6|SYC_CLOBK Cysteine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=cysS PE=3 SV=1 235 574 1.0E-54
sp|A1RYM3|SYC_THEPD Cysteine--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=cysS PE=3 SV=1 235 583 1.0E-54
sp|Q5L429|SYC_GEOKA Cysteine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=cysS PE=3 SV=1 236 659 1.0E-54
sp|A7GJ96|SYC_CLOBL Cysteine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=cysS PE=3 SV=1 235 574 1.0E-54
sp|Q49V39|SYC_STAS1 Cysteine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysS PE=3 SV=1 236 551 1.0E-54
sp|B2G5S5|SYC_LACRJ Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=cysS PE=3 SV=1 207 659 1.0E-54
sp|A5VI99|SYC_LACRD Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=cysS PE=3 SV=1 207 659 1.0E-54
sp|A5I7M8|SYC_CLOBH Cysteine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=cysS PE=3 SV=1 235 574 2.0E-54
sp|A7FZ91|SYC_CLOB1 Cysteine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=cysS PE=3 SV=1 235 574 2.0E-54
sp|A5D5M0|SYC_PELTS Cysteine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=cysS PE=3 SV=1 236 555 3.0E-54
sp|B1KTA5|SYC_CLOBM Cysteine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=cysS PE=3 SV=1 235 574 3.0E-54
sp|B9DKW3|SYC_STACT Cysteine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=cysS PE=3 SV=1 218 551 3.0E-54
sp|Q6NFC3|SYC_CORDI Cysteine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=cysS PE=3 SV=1 215 467 3.0E-54
sp|A4YIG5|SYC_METS5 Cysteine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=cysS PE=3 SV=1 237 545 3.0E-54
sp|A7Z0L6|SYC_BACMF Cysteine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysS PE=3 SV=1 245 576 6.0E-54
sp|B8F392|SYC_HAEPS Cysteine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=cysS PE=3 SV=1 212 581 6.0E-54
sp|Q9WZH8|SYC_THEMA Cysteine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cysS PE=3 SV=1 174 579 7.0E-54
sp|Q5WLT3|SYC_BACSK Cysteine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=cysS PE=3 SV=1 236 552 8.0E-54
sp|Q7MLR5|SYC_VIBVY Cysteine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=cysS PE=3 SV=2 248 548 9.0E-54
sp|Q8D8R1|SYC_VIBVU Cysteine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=cysS PE=3 SV=2 248 548 9.0E-54
sp|Q5MZA4|SYC_SYNP6 Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cysS PE=3 SV=1 235 659 1.0E-53
sp|Q31MM7|SYC_SYNE7 Cysteine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=cysS PE=3 SV=1 235 659 1.0E-53
sp|A2RMS1|SYC_LACLM Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=cysS PE=3 SV=1 220 481 1.0E-53
sp|A0Q4Q1|SYC_FRATN Cysteine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=cysS PE=3 SV=1 249 548 2.0E-53
sp|A4QH41|SYC_CORGB Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain R) GN=cysS PE=3 SV=1 215 468 2.0E-53
sp|A4IWF2|SYC_FRATW Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysS PE=3 SV=1 249 548 2.0E-53
sp|Q0BKI3|SYC_FRATO Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cysS PE=3 SV=1 249 548 2.0E-53
sp|Q2A1T7|SYC_FRATH Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cysS PE=3 SV=1 249 548 2.0E-53
sp|A7NE53|SYC_FRATF Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cysS PE=3 SV=1 249 548 2.0E-53
sp|Q07ZX5|SYC_SHEFN Cysteine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysS PE=3 SV=1 236 579 2.0E-53
sp|Q2SK40|SYC_HAHCH Cysteine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=cysS PE=3 SV=1 214 661 2.0E-53
sp|Q02WZ9|SYC_LACLS Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=cysS PE=3 SV=1 221 481 2.0E-53
sp|Q8NMD7|SYC_CORGL Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cysS PE=3 SV=1 215 498 2.0E-53
sp|B0U0I3|SYC_FRAP2 Cysteine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=cysS PE=3 SV=1 207 548 2.0E-53
sp|B4U570|SYC_STREM Cysteine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=cysS PE=3 SV=1 235 579 3.0E-53
sp|Q97WE6|SYC_SULSO Cysteine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cysS PE=3 SV=1 237 544 3.0E-53
sp|A8FTH6|SYC_SHESH Cysteine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=cysS PE=3 SV=1 248 628 3.0E-53
sp|C1DHE6|SYC_AZOVD Cysteine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysS PE=3 SV=1 247 548 3.0E-53
sp|Q83BL7|SYC_COXBU Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cysS PE=1 SV=2 236 661 4.0E-53
sp|Q96YC3|SYC_SULTO Cysteine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cysS PE=3 SV=2 237 658 4.0E-53
sp|Q2RFM3|SYC_MOOTA Cysteine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=cysS PE=3 SV=1 237 659 4.0E-53
sp|Q48RA7|SYC_STRPM Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cysS PE=3 SV=1 220 659 4.0E-53
sp|Q8NZD1|SYC_STRP8 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cysS PE=3 SV=1 220 659 4.0E-53
sp|A6VQ79|SYC_ACTSZ Cysteine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysS PE=3 SV=1 207 548 5.0E-53
sp|A9KBJ2|SYC_COXBN Cysteine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cysS PE=3 SV=1 236 661 5.0E-53
sp|A9N924|SYC_COXBR Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cysS PE=3 SV=1 236 661 5.0E-53
sp|C1D7F5|SYC_LARHH Cysteine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=cysS PE=3 SV=1 247 659 5.0E-53
sp|Q5NEL1|SYC_FRATT Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysS PE=3 SV=1 249 548 6.0E-53
sp|Q14G14|SYC_FRAT1 Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysS PE=3 SV=1 249 548 6.0E-53
sp|B2SFH9|SYC_FRATM Cysteine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=cysS PE=3 SV=1 249 548 6.0E-53
sp|B6ISG4|SYC_RHOCS Cysteine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=cysS PE=3 SV=1 214 545 6.0E-53
sp|Q0A7N3|SYC_ALKEH Cysteine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysS PE=3 SV=2 247 548 6.0E-53
sp|Q048S9|SYC_LACDB Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=cysS PE=3 SV=1 237 579 7.0E-53
sp|Q03ZR0|SYC_LEUMM Cysteine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=cysS PE=3 SV=1 237 579 7.0E-53
sp|Q87YQ2|SYC_PSESM Cysteine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysS PE=3 SV=1 247 548 8.0E-53
sp|P0DG33|SYC_STRPQ Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cysS PE=3 SV=1 220 659 9.0E-53
sp|P0DG32|SYC_STRP3 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cysS PE=3 SV=1 220 659 9.0E-53
sp|Q4JCA6|SYC_SULAC Cysteine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cysS PE=3 SV=1 235 543 9.0E-53
sp|B7GJ46|SYC_ANOFW Cysteine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysS PE=3 SV=1 236 579 1.0E-52
sp|Q1G8Z0|SYC_LACDA Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=cysS PE=3 SV=1 237 579 1.0E-52
sp|A1U1Q7|SYC_MARHV Cysteine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysS PE=3 SV=1 247 659 1.0E-52
sp|Q1H417|SYC_METFK Cysteine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysS PE=3 SV=1 247 575 1.0E-52
sp|A5FP90|SYC_DEHMB Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=cysS PE=3 SV=1 245 556 1.0E-52
sp|Q3ZAD5|SYC_DEHM1 Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=cysS PE=3 SV=1 245 475 1.0E-52
sp|A3DH43|SYC_CLOTH Cysteine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=cysS PE=3 SV=1 235 553 1.0E-52
sp|B5YID4|SYC_THEYD Cysteine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysS PE=3 SV=1 235 577 1.0E-52
sp|Q65UY1|SYC_MANSM Cysteine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysS PE=3 SV=2 207 548 1.0E-52
sp|Q4K9S1|SYC_PSEF5 Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysS PE=3 SV=1 247 548 1.0E-52
sp|Q5UP36|SYC_MIMIV Cysteine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=CARS PE=3 SV=1 237 659 2.0E-52
sp|Q5X9W5|SYC_STRP6 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysS PE=3 SV=1 220 659 2.0E-52
sp|Q99XZ9|SYC_STRP1 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=cysS PE=3 SV=1 220 659 2.0E-52
sp|B3GXR0|SYC_ACTP7 Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysS PE=3 SV=1 207 548 2.0E-52
sp|Q4ZVN9|SYC_PSEU2 Cysteine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysS PE=3 SV=1 247 548 2.0E-52
sp|Q6AJ23|SYC_DESPS Cysteine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=cysS PE=3 SV=1 234 548 2.0E-52
sp|Q48L06|SYC_PSE14 Cysteine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysS PE=3 SV=1 247 579 2.0E-52
sp|Q9CEJ0|SYC_LACLA Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=cysS PE=3 SV=1 245 548 2.0E-52
sp|B9LZV4|SYC_GEODF Cysteine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysS PE=3 SV=1 244 548 2.0E-52
sp|A8H617|SYC_SHEPA Cysteine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysS PE=3 SV=1 236 628 3.0E-52
sp|B0BPJ8|SYC_ACTPJ Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysS PE=3 SV=1 207 548 3.0E-52
sp|B8GNT5|SYC_THISH Cysteine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysS PE=3 SV=1 235 548 3.0E-52
sp|B1YGS9|SYC_EXIS2 Cysteine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=cysS PE=3 SV=1 218 551 3.0E-52
sp|Q978Z5|SYC_THEVO Cysteine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=cysS PE=3 SV=2 237 467 4.0E-52
sp|B3E1P0|SYC_GEOLS Cysteine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=cysS PE=3 SV=1 235 548 4.0E-52
sp|B1L7Y7|SYC_THESQ Cysteine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=cysS PE=3 SV=1 217 579 4.0E-52
sp|A5IJ66|SYC_THEP1 Cysteine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=cysS PE=3 SV=1 217 579 4.0E-52
sp|A3N0S3|SYC_ACTP2 Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysS PE=3 SV=1 207 548 5.0E-52
sp|Q8FMI8|SYC_COREF Cysteine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cysS PE=3 SV=2 215 498 5.0E-52
sp|P57890|SYC_PASMU Cysteine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=cysS PE=3 SV=1 214 548 5.0E-52
sp|Q6FC71|SYC_ACIAD Cysteine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysS PE=3 SV=1 247 548 6.0E-52
sp|A8F962|SYC_BACP2 Cysteine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=cysS PE=3 SV=1 236 551 6.0E-52
sp|Q8EG22|SYC_SHEON Cysteine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=cysS PE=3 SV=1 247 579 7.0E-52
sp|A6VX53|SYC_MARMS Cysteine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=cysS PE=3 SV=1 247 548 8.0E-52
sp|Q3ZWG4|SYC_DEHMC Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=cysS PE=3 SV=1 245 556 8.0E-52
sp|A8MLB7|SYC_ALKOO Cysteine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=cysS PE=3 SV=1 244 554 1.0E-51
sp|A8YZM7|SYC_STAAT Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cysS PE=3 SV=2 237 551 1.0E-51
sp|A6QEI2|SYC_STAAE Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q5HIE5|SYC_STAAC Cysteine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q2G2M6|SYC_STAA8 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q2FJB0|SYC_STAA3 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|A4VL73|SYC_PSEU5 Cysteine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=cysS PE=3 SV=2 247 548 1.0E-51
sp|A9BGT9|SYC_PETMO Cysteine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=cysS PE=3 SV=1 185 629 1.0E-51
sp|Q5FM34|SYC_LACAC Cysteine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=cysS PE=3 SV=1 237 629 1.0E-51
sp|Q31H54|SYC_THICR Cysteine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysS PE=3 SV=1 174 573 1.0E-51
sp|Q99W73|SYC_STAAN Cysteine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=cysS PE=1 SV=1 237 551 1.0E-51
sp|Q932G0|SYC_STAAM Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysS PE=3 SV=2 237 551 1.0E-51
sp|A5IQ83|SYC_STAA9 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|A6TZ06|SYC_STAA2 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|A7WYU7|SYC_STAA1 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q2IQG7|SYC_ANADE Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=cysS PE=3 SV=1 213 578 1.0E-51
sp|Q8NXY7|SYC_STAAW Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q6GBV8|SYC_STAAS Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|Q6GJD9|SYC_STAAR Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=cysS PE=3 SV=1 237 551 1.0E-51
sp|B8CRG0|SYC_SHEPW Cysteine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysS PE=3 SV=1 248 628 1.0E-51
sp|Q9HJ27|SYC_THEAC Cysteine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=cysS PE=3 SV=1 220 546 1.0E-51
sp|Q13X60|SYC_BURXL Cysteine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=cysS PE=3 SV=1 221 548 2.0E-51
sp|C3JYD3|SYC_PSEFS Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=cysS PE=3 SV=1 247 548 2.0E-51
sp|B1I0T1|SYC_DESAP Cysteine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=cysS PE=3 SV=1 235 629 2.0E-51
sp|C4Z3N5|SYC_EUBE2 Cysteine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=cysS PE=3 SV=1 247 544 2.0E-51
sp|Q2YSD1|SYC_STAAB Cysteine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cysS PE=3 SV=1 237 551 2.0E-51
sp|B2GAB5|SYC_LACF3 Cysteine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cysS PE=3 SV=1 207 554 2.0E-51
sp|Q1QVV6|SYC_CHRSD Cysteine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysS PE=3 SV=1 202 663 2.0E-51
sp|A5WEW9|SYC_PSYWF Cysteine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=cysS PE=3 SV=1 247 548 3.0E-51
sp|Q92R20|SYC_RHIME Cysteine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=cysS PE=3 SV=1 198 463 3.0E-51
sp|A0KYM2|SYC_SHESA Cysteine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=cysS PE=3 SV=1 247 579 4.0E-51
sp|A9KSM5|SYC_CLOPH Cysteine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=cysS PE=3 SV=1 244 659 4.0E-51
sp|A7MK00|SYC_CROS8 Cysteine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysS PE=3 SV=2 214 548 4.0E-51
sp|C3LNF1|SYC_VIBCM Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysS PE=3 SV=1 221 548 4.0E-51
sp|Q9KQZ9|SYC_VIBCH Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysS PE=3 SV=1 221 548 4.0E-51
sp|A5F763|SYC_VIBC3 Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysS PE=3 SV=1 221 548 4.0E-51
sp|Q10XJ9|SYC_TRIEI Cysteine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=cysS PE=3 SV=1 236 611 5.0E-51
sp|A7HDA1|SYC_ANADF Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=cysS PE=3 SV=1 236 579 5.0E-51
sp|A6WLP8|SYC_SHEB8 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=cysS PE=3 SV=1 247 594 7.0E-51
sp|B8E5F2|SYC_SHEB2 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=cysS PE=3 SV=1 247 594 7.0E-51
sp|Q6LT67|SYC1_PHOPR Cysteine--tRNA ligase 1 OS=Photobacterium profundum GN=cysS1 PE=3 SV=1 247 548 8.0E-51
sp|Q72BQ5|SYC_DESVH Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=cysS PE=3 SV=1 234 659 8.0E-51
sp|A9KWH4|SYC_SHEB9 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=cysS PE=3 SV=1 247 594 8.0E-51
sp|Q3SHN1|SYC_THIDA Cysteine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysS PE=3 SV=1 174 575 8.0E-51
sp|A3D302|SYC_SHEB5 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysS PE=3 SV=1 247 594 8.0E-51
sp|A3QFX9|SYC_SHELP Cysteine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysS PE=3 SV=1 244 548 9.0E-51
sp|Q3KA28|SYC_PSEPF Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysS PE=3 SV=1 247 548 9.0E-51
sp|Q8ETZ9|SYC_OCEIH Cysteine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysS PE=3 SV=1 237 579 1.0E-50
sp|B1KLU0|SYC_SHEWM Cysteine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysS PE=3 SV=1 247 581 1.0E-50
sp|Q7VMA0|SYC_HAEDU Cysteine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cysS PE=3 SV=1 212 548 1.0E-50
sp|B9KAQ8|SYC_THENN Cysteine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=cysS PE=3 SV=1 237 629 1.0E-50
sp|A5IBG0|SYC_LEGPC Cysteine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=cysS PE=3 SV=1 174 548 1.0E-50
sp|Q88YX9|SYC_LACPL Cysteine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysS PE=3 SV=1 183 550 1.0E-50
sp|Q5WX29|SYC_LEGPL Cysteine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=cysS PE=3 SV=1 174 548 1.0E-50
sp|Q045X8|SYC_LACGA Cysteine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=cysS PE=3 SV=1 218 584 1.0E-50
sp|Q5ZVY1|SYC_LEGPH Cysteine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cysS PE=3 SV=1 214 548 1.0E-50
sp|Q8TSP6|SYC_METAC Cysteine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cysS PE=3 SV=1 241 585 1.0E-50
sp|Q3BSH9|SYC_XANC5 Cysteine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysS PE=3 SV=1 245 545 1.0E-50
sp|A6U7D9|SYC_SINMW Cysteine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=cysS PE=3 SV=1 198 463 1.0E-50
sp|A5UFP3|SYC_HAEIG Cysteine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=cysS PE=3 SV=1 207 548 2.0E-50
sp|Q4QPG7|SYC_HAEI8 Cysteine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=cysS PE=3 SV=1 207 548 2.0E-50
sp|A8F596|SYC_PSELT Cysteine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=cysS PE=3 SV=1 208 581 2.0E-50
sp|C4XSW5|SYC_DESMR Cysteine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=cysS PE=3 SV=1 221 659 2.0E-50
sp|B1MW68|SYC_LEUCK Cysteine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=cysS PE=3 SV=1 236 660 2.0E-50
sp|Q250Q6|SYC_DESHY Cysteine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=cysS PE=3 SV=1 237 659 2.0E-50
sp|B8G1U2|SYC_DESHD Cysteine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=cysS PE=3 SV=1 237 659 2.0E-50
sp|B1JHJ1|SYC_YERPY Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysS PE=3 SV=1 221 659 2.0E-50
sp|Q5GZD9|SYC_XANOR Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysS PE=3 SV=1 245 552 2.0E-50
sp|Q2P2E8|SYC_XANOM Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysS PE=3 SV=1 245 552 2.0E-50
sp|Q0HTK4|SYC_SHESR Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=cysS PE=3 SV=1 247 579 2.0E-50
sp|Q6MKR7|SYC_BDEBA Cysteine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=cysS PE=3 SV=1 237 659 3.0E-50
sp|Q8PK23|SYC_XANAC Cysteine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysS PE=3 SV=1 245 552 3.0E-50
sp|A4TP63|SYC_YERPP Cysteine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|Q1CKY1|SYC_YERPN Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|A9R253|SYC_YERPG Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|Q8ZCC0|SYC_YERPE Cysteine--tRNA ligase OS=Yersinia pestis GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|Q1C4U1|SYC_YERPA Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|A7FL46|SYC_YERP3 Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|B4U9I4|SYC_HYDS0 Cysteine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=cysS PE=3 SV=1 236 548 3.0E-50
sp|Q0HH98|SYC_SHESM Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=cysS PE=3 SV=1 247 579 3.0E-50
sp|Q66DK9|SYC_YERPS Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|B2K7N2|SYC_YERPB Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysS PE=3 SV=1 221 659 3.0E-50
sp|C6BS23|SYC_DESAD Cysteine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=cysS PE=3 SV=1 234 659 3.0E-50
sp|Q1IBP9|SYC_PSEE4 Cysteine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=cysS PE=3 SV=1 247 548 3.0E-50
sp|Q1WSS5|SYC_LACS1 Cysteine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=cysS PE=3 SV=1 245 630 3.0E-50
sp|Q9YBK6|SYC_AERPE Cysteine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysS PE=3 SV=2 235 551 4.0E-50
sp|Q47HK6|SYC_DECAR Cysteine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=cysS PE=3 SV=1 221 659 4.0E-50
sp|Q9KGF4|SYC_BACHD Cysteine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysS PE=3 SV=1 236 551 4.0E-50
sp|Q2JTF4|SYC_SYNJA Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysS PE=3 SV=1 202 659 4.0E-50
sp|A8AB68|SYC_IGNH4 Cysteine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=cysS PE=3 SV=1 235 587 5.0E-50
sp|Q8PVQ1|SYC_METMA Cysteine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cysS PE=3 SV=1 241 588 6.0E-50
sp|A1VDQ5|SYC_DESVV Cysteine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=cysS PE=3 SV=1 234 659 7.0E-50
sp|Q9I2U7|SYC_PSEAE Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysS PE=3 SV=1 247 548 7.0E-50
sp|B7VB84|SYC_PSEA8 Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysS PE=3 SV=1 247 548 7.0E-50
sp|A7HKV1|SYC_FERNB Cysteine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=cysS PE=3 SV=1 235 629 8.0E-50
sp|A1JNP9|SYC_YERE8 Cysteine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysS PE=3 SV=1 174 659 8.0E-50
sp|Q02KT6|SYC_PSEAB Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysS PE=3 SV=1 247 548 8.0E-50
sp|A6V727|SYC_PSEA7 Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=cysS PE=3 SV=1 247 548 8.0E-50
sp|Q5X5P9|SYC_LEGPA Cysteine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=cysS PE=3 SV=1 214 548 8.0E-50
sp|Q18CD5|SYC_PEPD6 Cysteine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=cysS PE=3 SV=2 218 548 8.0E-50
sp|Q5V2M3|SYC_HALMA Cysteine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cysS PE=3 SV=1 202 629 9.0E-50
sp|A1RTJ7|SYC_PYRIL Cysteine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=cysS PE=3 SV=1 235 540 1.0E-49
sp|B0KUU0|SYC_PSEPG Cysteine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=cysS PE=3 SV=1 247 548 1.0E-49
sp|P43816|SYC_HAEIN Cysteine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysS PE=3 SV=1 207 548 1.0E-49
sp|Q1MJ22|SYC_RHIL3 Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=cysS PE=3 SV=1 198 463 1.0E-49
sp|A4Y5H9|SYC_SHEPC Cysteine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysS PE=3 SV=1 248 579 1.0E-49
sp|A1RL92|SYC_SHESW Cysteine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=cysS PE=3 SV=1 248 579 1.0E-49
sp|A8GAY0|SYC_SERP5 Cysteine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=cysS PE=3 SV=1 174 595 1.0E-49
sp|B6JHT8|SYC_OLICO Cysteine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysS PE=3 SV=1 243 463 2.0E-49
sp|Q4FRZ9|SYC_PSYA2 Cysteine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=cysS PE=3 SV=1 236 548 2.0E-49
sp|A5W458|SYC_PSEP1 Cysteine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysS PE=3 SV=1 247 548 2.0E-49
sp|B7JUH4|SYC_CYAP8 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=cysS PE=3 SV=1 177 659 2.0E-49
sp|B7IFB7|SYC_THEAB Cysteine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=cysS PE=3 SV=1 237 659 2.0E-49
sp|Q21JG6|SYC_SACD2 Cysteine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysS PE=3 SV=1 214 467 2.0E-49
sp|Q88IU4|SYC_PSEPK Cysteine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=cysS PE=3 SV=1 247 548 2.0E-49
sp|A3MS54|SYC_PYRCJ Cysteine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=cysS PE=3 SV=1 235 540 2.0E-49
sp|B0JJL5|SYC_MICAN Cysteine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=cysS PE=3 SV=1 177 546 3.0E-49
sp|A8YTD3|SYC_LACH4 Cysteine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=cysS PE=3 SV=1 237 659 3.0E-49
sp|A4XVG1|SYC_PSEMY Cysteine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=cysS PE=3 SV=1 247 548 3.0E-49
sp|Q7NX82|SYC_CHRVO Cysteine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysS PE=3 SV=2 174 583 3.0E-49
sp|Q5QYP3|SYC_IDILO Cysteine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cysS PE=3 SV=1 247 548 3.0E-49
sp|B8JDH1|SYC_ANAD2 Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=cysS PE=3 SV=1 213 577 3.0E-49
sp|B4UGC3|SYC_ANASK Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=cysS PE=3 SV=1 213 577 4.0E-49
sp|Q12L98|SYC_SHEDO Cysteine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysS PE=3 SV=1 236 548 5.0E-49
sp|B1YA45|SYC_PYRNV Cysteine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=cysS PE=3 SV=1 235 540 5.0E-49
sp|Q3J8Y9|SYC_NITOC Cysteine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysS PE=3 SV=1 236 548 6.0E-49
sp|Q46BZ5|SYC_METBF Cysteine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=cysS PE=3 SV=1 241 577 6.0E-49
sp|Q3APK6|SYC_CHLCH Cysteine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=cysS PE=3 SV=1 229 555 7.0E-49
sp|Q03SU6|SYC_LACBA Cysteine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cysS PE=3 SV=1 214 475 8.0E-49
sp|Q3IF51|SYC_PSEHT Cysteine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysS PE=3 SV=1 214 655 8.0E-49
sp|A6SZV1|SYC_JANMA Cysteine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=cysS PE=3 SV=1 247 548 9.0E-49
sp|Q8ZYD8|SYC_PYRAE Cysteine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cysS PE=3 SV=1 243 543 9.0E-49
sp|A3M419|SYC_ACIBT Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cysS PE=3 SV=2 247 548 1.0E-48
sp|B2HX34|SYC_ACIBC Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=cysS PE=3 SV=1 247 548 1.0E-48
sp|A1S4X2|SYC_SHEAM Cysteine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysS PE=3 SV=1 248 594 1.0E-48
sp|Q74L26|SYC_LACJO Cysteine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=cysS PE=3 SV=1 218 564 1.0E-48
sp|A2BXK1|SYC_PROM5 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=cysS PE=3 SV=1 245 601 1.0E-48
sp|B1J805|SYC_PSEPW Cysteine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=cysS PE=3 SV=1 247 548 1.0E-48
sp|A4G4M2|SYC_HERAR Cysteine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=cysS PE=3 SV=1 247 548 1.0E-48
sp|B5ZWB3|SYC_RHILW Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=cysS PE=3 SV=1 198 463 1.0E-48
sp|Q03E41|SYC_PEDPA Cysteine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=cysS PE=3 SV=1 214 579 2.0E-48
sp|Q7V0W1|SYC_PROMP Cysteine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cysS PE=3 SV=1 243 601 2.0E-48
sp|B4F1M6|SYC_PROMH Cysteine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=cysS PE=3 SV=1 221 581 2.0E-48
sp|B0VAU1|SYC_ACIBY Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=cysS PE=3 SV=1 247 548 2.0E-48
sp|B7IBU3|SYC_ACIB5 Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=cysS PE=3 SV=1 247 548 2.0E-48
sp|B7GWA1|SYC_ACIB3 Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=cysS PE=3 SV=1 247 548 2.0E-48
sp|Q1QC19|SYC_PSYCK Cysteine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=cysS PE=3 SV=1 236 548 2.0E-48
sp|B1XND1|SYC_SYNP2 Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysS PE=3 SV=1 236 480 2.0E-48
sp|A0L4P8|SYC_MAGMM Cysteine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=cysS PE=3 SV=1 235 659 2.0E-48
sp|B2IEE1|SYC_BEII9 Cysteine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=cysS PE=3 SV=1 235 543 3.0E-48
sp|B4ED73|SYC_BURCJ Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cysS PE=3 SV=1 221 548 3.0E-48
sp|Q8DHW6|SYC_THEEB Cysteine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysS PE=3 SV=2 201 669 3.0E-48
sp|B3R4D1|SYC_CUPTR Cysteine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=cysS PE=3 SV=1 247 548 3.0E-48
sp|C5BI15|SYC_TERTT Cysteine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysS PE=3 SV=1 214 544 4.0E-48
sp|Q2KAA8|SYC_RHIEC Cysteine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=cysS PE=3 SV=1 198 463 4.0E-48
sp|Q87EL7|SYC_XYLFT Cysteine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysS PE=3 SV=2 245 568 4.0E-48
sp|Q7N0S5|SYC_PHOLL Cysteine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysS PE=3 SV=1 212 548 4.0E-48
sp|Q2SX78|SYC_BURTA Cysteine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cysS PE=3 SV=1 248 548 7.0E-48
sp|Q839V5|SYC_ENTFA Cysteine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cysS PE=3 SV=1 207 579 8.0E-48
sp|B8J0S2|SYC_DESDA Cysteine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=cysS PE=3 SV=1 235 548 8.0E-48
sp|Q39EY8|SYC2_BURL3 Cysteine--tRNA ligase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cysS2 PE=3 SV=1 221 548 9.0E-48
sp|B0VS71|SYC_ACIBS Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=cysS PE=3 SV=1 247 548 9.0E-48
sp|A3Q6W0|SYC_MYCSJ Cysteine--tRNA ligase OS=Mycobacterium sp. (strain JLS) GN=cysS PE=3 SV=1 238 578 1.0E-47
sp|B8DKL0|SYC_DESVM Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=cysS PE=3 SV=1 234 659 1.0E-47
sp|Q1B2P3|SYC_MYCSS Cysteine--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=cysS PE=3 SV=1 238 578 1.0E-47
sp|A1UMF5|SYC_MYCSK Cysteine--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=cysS PE=3 SV=1 238 578 1.0E-47
sp|Q2Y7U5|SYC_NITMU Cysteine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=cysS PE=3 SV=1 247 548 1.0E-47
sp|Q7NMB5|SYC_GLOVI Cysteine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=cysS PE=3 SV=1 174 473 1.0E-47
sp|A9AHN6|SYC_BURM1 Cysteine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=cysS PE=3 SV=1 221 548 1.0E-47
sp|B9JCA5|SYC_AGRRK Cysteine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysS PE=3 SV=1 198 463 2.0E-47
sp|Q9HQL9|SYC_HALSA Cysteine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cysS PE=1 SV=1 198 662 2.0E-47
sp|B3WA35|SYC_LACCB Cysteine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=cysS PE=3 SV=1 237 552 2.0E-47
sp|Q035S0|SYC_LACC3 Cysteine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=cysS PE=3 SV=2 237 552 2.0E-47
sp|A4JFD0|SYC_BURVG Cysteine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cysS PE=3 SV=1 235 548 3.0E-47
sp|Q5Z2R1|SYC_NOCFA Cysteine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=cysS PE=3 SV=1 238 589 3.0E-47
sp|Q38UZ6|SYC_LACSS Cysteine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=cysS PE=3 SV=1 183 579 3.0E-47
sp|B1YSM8|SYC_BURA4 Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=cysS PE=3 SV=1 202 548 3.0E-47
sp|Q63SS8|SYC_BURPS Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|A3NB50|SYC_BURP6 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|Q3JQT6|SYC_BURP1 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|A3NWX8|SYC_BURP0 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|A1V5G8|SYC_BURMS Cysteine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|Q62J37|SYC_BURMA Cysteine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|A2SAX8|SYC_BURM9 Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|A3ML43|SYC_BURM7 Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=cysS PE=3 SV=1 221 548 3.0E-47
sp|Q3STA1|SYC_NITWN Cysteine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysS PE=3 SV=1 244 543 4.0E-47
sp|B7N980|SYC_ECOLU Cysteine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysS PE=3 SV=1 247 583 4.0E-47
sp|A0K8K2|SYC_BURCH Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=cysS PE=3 SV=1 221 548 5.0E-47
sp|Q1BHP1|SYC_BURCA Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=cysS PE=3 SV=1 221 548 5.0E-47
sp|A2BS39|SYC_PROMS Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=cysS PE=3 SV=1 245 552 5.0E-47
sp|Q74MI1|SYC_NANEQ Cysteine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=cysS PE=3 SV=1 246 548 5.0E-47
sp|Q8UGG4|SYC_AGRFC Cysteine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysS PE=3 SV=1 244 463 6.0E-47
sp|Q60BG8|SYC_METCA Cysteine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysS PE=3 SV=1 236 548 7.0E-47
sp|B7K7T8|SYC_CYAP7 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=cysS PE=3 SV=1 177 489 7.0E-47
sp|Q47TG4|SYC_THEFY Cysteine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=cysS PE=3 SV=1 245 659 7.0E-47
sp|A3PDX8|SYC_PROM0 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=cysS PE=3 SV=1 244 552 8.0E-47
sp|B1JUK8|SYC_BURCC Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=cysS PE=3 SV=1 221 548 8.0E-47
sp|B2U9P8|SYC_RALPJ Cysteine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=cysS PE=3 SV=1 221 548 8.0E-47
sp|Q9PEN3|SYC_XYLFA Cysteine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=cysS PE=3 SV=2 245 568 9.0E-47
sp|A4WH15|SYC_PYRAR Cysteine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=cysS PE=3 SV=1 235 536 9.0E-47
sp|Q0BDV4|SYC_BURCM Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysS PE=3 SV=1 221 548 9.0E-47
sp|P9WFW0|SYC_MYCTO Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysS PE=3 SV=1 215 557 9.0E-47
sp|P57990|SYC_MYCLE Cysteine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=cysS PE=3 SV=1 215 490 9.0E-47
sp|B8ZUA9|SYC_MYCLB Cysteine--tRNA ligase OS=Mycobacterium leprae (strain Br4923) GN=cysS PE=3 SV=1 215 490 9.0E-47
sp|Q319Z9|SYC_PROM9 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=cysS PE=3 SV=1 245 552 9.0E-47
sp|Q8ZR68|SYC_SALTY Cysteine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|C0PVI8|SYC_SALPC Cysteine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|B5R6X0|SYC_SALG2 Cysteine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|B5QUV0|SYC_SALEP Cysteine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|Q57S29|SYC_SALCH Cysteine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|B5EYD7|SYC_SALA4 Cysteine--tRNA ligase OS=Salmonella agona (strain SL483) GN=cysS PE=3 SV=1 247 548 9.0E-47
sp|C5B8V6|SYC_EDWI9 Cysteine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=cysS PE=3 SV=1 214 659 1.0E-46
sp|P9WFW1|SYC_MYCTU Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysS PE=1 SV=1 215 557 1.0E-46
sp|A5U8Q5|SYC_MYCTA Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cysS PE=3 SV=1 215 557 1.0E-46
sp|C1AI39|SYC_MYCBT Cysteine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=cysS PE=3 SV=1 215 557 1.0E-46
sp|A1KPR6|SYC_MYCBP Cysteine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=cysS PE=3 SV=1 215 557 1.0E-46
sp|P0A635|SYC_MYCBO Cysteine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysS PE=3 SV=1 215 557 1.0E-46
sp|Q8Z8P6|SYC_SALTI Cysteine--tRNA ligase OS=Salmonella typhi GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B4TN59|SYC_SALSV Cysteine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B5BCZ8|SYC_SALPK Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|A9MW31|SYC_SALPB Cysteine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|Q5PCE2|SYC_SALPA Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B4SXP2|SYC_SALNS Cysteine--tRNA ligase OS=Salmonella newport (strain SL254) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B4TA89|SYC_SALHS Cysteine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B5FLP7|SYC_SALDC Cysteine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|B0UVH6|SYC_HISS2 Cysteine--tRNA ligase OS=Histophilus somni (strain 2336) GN=cysS PE=3 SV=1 207 579 1.0E-46
sp|A9MLA7|SYC_SALAR Cysteine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|Q82GD0|SYC_STRAW Cysteine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cysS PE=3 SV=1 242 647 1.0E-46
sp|Q82Y45|SYC_NITEU Cysteine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysS PE=3 SV=1 247 548 1.0E-46
sp|Q1QN87|SYC_NITHX Cysteine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysS PE=3 SV=1 244 463 2.0E-46
sp|Q2JKL2|SYC_SYNJB Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysS PE=3 SV=1 202 659 2.0E-46
sp|Q984X8|SYC_RHILO Cysteine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=cysS PE=3 SV=1 198 463 2.0E-46
sp|A5EHE7|SYC_BRASB Cysteine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=cysS PE=3 SV=1 235 662 2.0E-46
sp|B7UKK3|SYC_ECO27 Cysteine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysS PE=3 SV=1 247 583 2.0E-46
sp|Q0KCA9|SYC_CUPNH Cysteine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cysS PE=3 SV=1 247 548 2.0E-46
sp|A0PV27|SYC_MYCUA Cysteine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=cysS PE=3 SV=1 215 557 2.0E-46
sp|P74330|SYC_SYNY3 Cysteine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysS PE=3 SV=1 177 558 2.0E-46
sp|Q0BXB7|SYC_HYPNA Cysteine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=cysS PE=3 SV=1 214 548 3.0E-46
sp|Q47XL5|SYC_COLP3 Cysteine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysS PE=3 SV=1 174 543 3.0E-46
sp|Q473D3|SYC_CUPPJ Cysteine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=cysS PE=3 SV=1 247 548 3.0E-46
sp|Q0VML5|SYC_ALCBS Cysteine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysS PE=3 SV=1 214 525 3.0E-46
sp|A0R558|SYC_MYCS2 Cysteine--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=cysS PE=3 SV=1 238 557 3.0E-46
sp|Q0I1Q1|SYC_HAES1 Cysteine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=cysS PE=3 SV=1 207 581 3.0E-46
sp|A1WT89|SYC_HALHL Cysteine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysS PE=3 SV=1 247 542 3.0E-46
sp|Q3Z4P5|SYC_SHISS Cysteine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=cysS PE=3 SV=1 247 583 4.0E-46
sp|Q7VB63|SYC_PROMA Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysS PE=3 SV=1 244 466 4.0E-46
sp|Q0AJJ4|SYC_NITEC Cysteine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=cysS PE=3 SV=1 247 562 4.0E-46
sp|Q9PPB8|SYC_CAMJE Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysS PE=3 SV=1 237 580 4.0E-46
sp|A8FLL5|SYC_CAMJ8 Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=cysS PE=3 SV=1 237 580 4.0E-46
sp|A8G5S9|SYC_PROM2 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=cysS PE=3 SV=1 244 552 4.0E-46
sp|A4F6W7|SYC_SACEN Cysteine--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=cysS PE=3 SV=2 238 552 4.0E-46
sp|A6T5R2|SYC_KLEP7 Cysteine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysS PE=3 SV=1 212 548 4.0E-46
sp|B5Y0K6|SYC_KLEP3 Cysteine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=cysS PE=3 SV=1 212 548 4.0E-46
sp|Q324Y3|SYC_SHIBS Cysteine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysS PE=3 SV=1 247 583 5.0E-46
sp|A7HWJ0|SYC_PARL1 Cysteine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=cysS PE=3 SV=1 205 563 5.0E-46
sp|Q3M6R3|SYC_ANAVT Cysteine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=cysS PE=3 SV=1 245 464 5.0E-46
sp|B1LKE5|SYC_ECOSM Cysteine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysS PE=3 SV=1 247 583 5.0E-46
sp|Q0AM03|SYC_MARMM Cysteine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=cysS PE=3 SV=1 237 583 5.0E-46
sp|Q8YXW5|SYC_NOSS1 Cysteine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysS PE=3 SV=1 245 464 6.0E-46
sp|Q9JXE6|SYC_NEIMB Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysS PE=3 SV=1 207 548 6.0E-46
sp|Q5HUZ0|SYC_CAMJR Cysteine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=cysS PE=3 SV=1 237 580 6.0E-46
sp|A1VZF0|SYC_CAMJJ Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=cysS PE=3 SV=1 237 580 6.0E-46
sp|Q8P8J0|SYC_XANCP Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysS PE=3 SV=1 245 488 6.0E-46
sp|Q4UVJ3|SYC_XANC8 Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysS PE=3 SV=1 245 488 6.0E-46
sp|B2TTB3|SYC_SHIB3 Cysteine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysS PE=3 SV=1 247 583 6.0E-46
sp|C4LH17|SYC_CORK4 Cysteine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=cysS PE=3 SV=1 238 579 7.0E-46
sp|B8HQA4|SYC_CYAP4 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=cysS PE=3 SV=1 245 659 7.0E-46
sp|Q0T776|SYC_SHIF8 Cysteine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysS PE=3 SV=2 247 583 7.0E-46
sp|Q1RF08|SYC_ECOUT Cysteine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B6I0H1|SYC_ECOSE Cysteine--tRNA ligase OS=Escherichia coli (strain SE11) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|P21888|SYC_ECOLI Cysteine--tRNA ligase OS=Escherichia coli (strain K12) GN=cysS PE=1 SV=2 247 583 7.0E-46
sp|B1IZ75|SYC_ECOLC Cysteine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|Q8FK44|SYC_ECOL6 Cysteine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|A1A8J2|SYC_ECOK1 Cysteine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|A7ZXI1|SYC_ECOHS Cysteine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B1XGC4|SYC_ECODH Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|C4ZUX4|SYC_ECOBW Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B7M4M9|SYC_ECO8A Cysteine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B7MRI9|SYC_ECO81 Cysteine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B7NL20|SYC_ECO7I Cysteine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B7L7F3|SYC_ECO55 Cysteine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|B7ME49|SYC_ECO45 Cysteine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|A7ZIT5|SYC_ECO24 Cysteine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysS PE=3 SV=1 247 583 7.0E-46
sp|Q2NV45|SYC_SODGM Cysteine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=cysS PE=3 SV=1 243 548 9.0E-46
sp|B2HJ21|SYC_MYCMM Cysteine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=cysS PE=3 SV=1 215 557 9.0E-46
sp|Q83M27|SYC_SHIFL Cysteine--tRNA ligase OS=Shigella flexneri GN=cysS PE=3 SV=1 247 583 9.0E-46
sp|B0S0W3|SYC_FINM2 Cysteine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=cysS PE=3 SV=1 220 548 1.0E-45
sp|B5YPP1|SYC_ECO5E Cysteine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysS PE=3 SV=1 247 583 1.0E-45
sp|Q8XCT9|SYC_ECO57 Cysteine--tRNA ligase OS=Escherichia coli O157:H7 GN=cysS PE=3 SV=1 247 583 1.0E-45
sp|Q8Y077|SYC_RALSO Cysteine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=cysS PE=3 SV=1 221 548 1.0E-45
sp|C4K6G8|SYC_HAMD5 Cysteine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=cysS PE=3 SV=1 236 548 1.0E-45
sp|Q7VRB4|SYC_BLOFL Cysteine--tRNA ligase OS=Blochmannia floridanus GN=cysS PE=3 SV=1 237 662 1.0E-45
sp|Q9AAY2|SYC_CAUCR Cysteine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysS PE=3 SV=1 198 568 1.0E-45
sp|Q8SRE0|SYC_ENCCU Cysteine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0490 PE=1 SV=1 19 98 8.0E-25
sp|A9AAN8|SYC_METM6 Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=cysS PE=3 SV=1 18 99 2.0E-22
sp|A6VG07|SYC_METM7 Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=cysS PE=3 SV=1 18 98 3.0E-21
sp|O58370|SYC_PYRHO Cysteine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cysS PE=3 SV=1 19 133 1.0E-20
sp|Q8U227|SYC_PYRFU Cysteine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cysS PE=3 SV=2 18 99 1.0E-20
sp|Q6LYD1|SYC_METMP Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=cysS PE=3 SV=1 18 98 1.0E-20
sp|Q67JP9|SYC_SYMTH Cysteine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cysS PE=3 SV=1 19 129 4.0E-20
sp|C5A739|SYC_THEGJ Cysteine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=cysS PE=3 SV=1 21 99 1.0E-19
sp|Q5JD45|SYC_THEKO Cysteine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cysS PE=3 SV=1 21 147 1.0E-19
sp|Q8DHW6|SYC_THEEB Cysteine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysS PE=3 SV=2 19 99 1.0E-19
sp|Q2KIF8|SYCM_BOVIN Cysteine--tRNA ligase, mitochondrial OS=Bos taurus GN=CARS2 PE=2 SV=1 21 98 2.0E-19
sp|B6YUQ3|SYC_THEON Cysteine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=cysS PE=3 SV=1 21 133 2.0E-19
sp|Q9HA77|SYCM_HUMAN Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens GN=CARS2 PE=1 SV=1 16 101 2.0E-19
sp|B6EH43|SYC_ALISL Cysteine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=cysS PE=3 SV=1 18 117 2.0E-19
sp|Q9UYV2|SYC_PYRAB Cysteine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysS PE=3 SV=1 21 147 3.0E-19
sp|Q18CD5|SYC_PEPD6 Cysteine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=cysS PE=3 SV=2 19 98 3.0E-19
sp|C0QRE6|SYC_PERMH Cysteine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=cysS PE=3 SV=1 19 133 4.0E-19
sp|Q5E4F1|SYC_VIBF1 Cysteine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysS PE=3 SV=1 18 99 5.0E-19
sp|B8HQA4|SYC_CYAP4 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=cysS PE=3 SV=1 19 98 6.0E-19
sp|Q6PA41|SYCM_XENLA Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=cars2 PE=2 SV=1 7 98 8.0E-19
sp|Q8BYM8|SYCM_MOUSE Probable cysteine--tRNA ligase, mitochondrial OS=Mus musculus GN=Cars2 PE=1 SV=2 7 98 9.0E-19
sp|B7VGZ1|SYC_VIBTL Cysteine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=cysS PE=3 SV=1 18 99 1.0E-18
sp|A3DH43|SYC_CLOTH Cysteine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=cysS PE=3 SV=1 19 98 1.0E-18
sp|A0KYM2|SYC_SHESA Cysteine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=cysS PE=3 SV=1 17 117 1.0E-18
sp|Q0HTK4|SYC_SHESR Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=cysS PE=3 SV=1 17 117 1.0E-18
sp|A4Y5H9|SYC_SHEPC Cysteine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysS PE=3 SV=1 17 117 1.0E-18
sp|Q54ZY3|SYCM_DICDI Probable cysteine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mcysS PE=3 SV=1 36 98 2.0E-18
sp|Q87QJ9|SYC_VIBPA Cysteine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysS PE=3 SV=1 18 99 2.0E-18
sp|A1RYM3|SYC_THEPD Cysteine--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=cysS PE=3 SV=1 18 97 2.0E-18
sp|Q87YQ2|SYC_PSESM Cysteine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysS PE=3 SV=1 18 122 2.0E-18
sp|Q8EG22|SYC_SHEON Cysteine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=cysS PE=3 SV=1 18 117 2.0E-18
sp|A8MLB7|SYC_ALKOO Cysteine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=cysS PE=3 SV=1 21 98 2.0E-18
sp|Q0HH98|SYC_SHESM Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=cysS PE=3 SV=1 17 117 2.0E-18
sp|A1RL92|SYC_SHESW Cysteine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=cysS PE=3 SV=1 17 117 2.0E-18
sp|Q54KR1|SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=cysS PE=3 SV=1 5 101 3.0E-18
sp|B0TLV2|SYC_SHEHH Cysteine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysS PE=3 SV=1 18 100 3.0E-18
sp|Q7MLR5|SYC_VIBVY Cysteine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=cysS PE=3 SV=2 18 99 3.0E-18
sp|Q8D8R1|SYC_VIBVU Cysteine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=cysS PE=3 SV=2 18 99 3.0E-18
sp|Q65UY1|SYC_MANSM Cysteine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysS PE=3 SV=2 18 100 3.0E-18
sp|A8H617|SYC_SHEPA Cysteine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysS PE=3 SV=1 18 117 3.0E-18
sp|C3LNF1|SYC_VIBCM Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysS PE=3 SV=1 18 99 3.0E-18
sp|Q9KQZ9|SYC_VIBCH Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysS PE=3 SV=1 18 99 3.0E-18
sp|A5F763|SYC_VIBC3 Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysS PE=3 SV=1 18 99 3.0E-18
sp|A6UP68|SYC_METVS Cysteine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=cysS PE=3 SV=1 18 96 4.0E-18
sp|A0LIR9|SYC_SYNFM Cysteine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=cysS PE=3 SV=1 18 96 4.0E-18
sp|Q5MZA4|SYC_SYNP6 Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cysS PE=3 SV=1 18 98 4.0E-18
sp|Q31MM7|SYC_SYNE7 Cysteine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=cysS PE=3 SV=1 18 98 4.0E-18
sp|Q48L06|SYC_PSE14 Cysteine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysS PE=3 SV=1 18 122 4.0E-18
sp|B0K5F6|SYC_THEPX Cysteine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=cysS PE=3 SV=1 21 126 6.0E-18
sp|B0KCH9|SYC_THEP3 Cysteine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=cysS PE=3 SV=1 21 126 6.0E-18
sp|Q2RFM3|SYC_MOOTA Cysteine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=cysS PE=3 SV=1 19 112 7.0E-18
sp|Q3SHN1|SYC_THIDA Cysteine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysS PE=3 SV=1 18 108 7.0E-18
sp|B3GXR0|SYC_ACTP7 Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysS PE=3 SV=1 18 121 8.0E-18
sp|A6VQ79|SYC_ACTSZ Cysteine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysS PE=3 SV=1 18 100 9.0E-18
sp|A8FTH6|SYC_SHESH Cysteine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=cysS PE=3 SV=1 18 99 1.0E-17
sp|Q4ZVN9|SYC_PSEU2 Cysteine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysS PE=3 SV=1 18 122 1.0E-17
sp|Q6LT67|SYC1_PHOPR Cysteine--tRNA ligase 1 OS=Photobacterium profundum GN=cysS1 PE=3 SV=1 18 99 1.0E-17
sp|B1KLU0|SYC_SHEWM Cysteine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysS PE=3 SV=1 18 117 1.0E-17
sp|Q9KGF4|SYC_BACHD Cysteine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysS PE=3 SV=1 19 112 1.0E-17
sp|Q8R7T3|SYC_CALS4 Cysteine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cysS PE=3 SV=1 21 103 2.0E-17
sp|A6TWK5|SYC_ALKMQ Cysteine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=cysS PE=3 SV=1 21 98 2.0E-17
sp|A0Q4Q1|SYC_FRATN Cysteine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|A4IWF2|SYC_FRATW Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|Q0BKI3|SYC_FRATO Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|Q2A1T7|SYC_FRATH Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|A7NE53|SYC_FRATF Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|Q5NEL1|SYC_FRATT Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|Q14G14|SYC_FRAT1 Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysS PE=3 SV=1 19 99 2.0E-17
sp|B0BPJ8|SYC_ACTPJ Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysS PE=3 SV=1 18 100 2.0E-17
sp|A3N0S3|SYC_ACTP2 Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysS PE=3 SV=1 18 100 2.0E-17
sp|A9KSM5|SYC_CLOPH Cysteine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=cysS PE=3 SV=1 19 98 2.0E-17
sp|Q7NMB5|SYC_GLOVI Cysteine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=cysS PE=3 SV=1 18 98 2.0E-17
sp|A3DLW5|SYC_STAMF Cysteine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=cysS PE=3 SV=1 21 98 3.0E-17
sp|Q07ZX5|SYC_SHEFN Cysteine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysS PE=3 SV=1 18 116 3.0E-17
sp|B8CRG0|SYC_SHEPW Cysteine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysS PE=3 SV=1 18 100 3.0E-17
sp|Q10XJ9|SYC_TRIEI Cysteine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=cysS PE=3 SV=1 18 99 3.0E-17
sp|A3QFX9|SYC_SHELP Cysteine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysS PE=3 SV=1 18 99 3.0E-17
sp|Q47XL5|SYC_COLP3 Cysteine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysS PE=3 SV=1 18 100 3.0E-17
sp|C4K6G8|SYC_HAMD5 Cysteine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=cysS PE=3 SV=1 18 121 3.0E-17
sp|B2V6B4|SYC_SULSY Cysteine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=cysS PE=3 SV=1 19 133 4.0E-17
sp|B8F392|SYC_HAEPS Cysteine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=cysS PE=3 SV=1 18 100 4.0E-17
sp|Q0A7N3|SYC_ALKEH Cysteine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysS PE=3 SV=2 18 96 4.0E-17
sp|C6BS23|SYC_DESAD Cysteine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=cysS PE=3 SV=1 19 99 4.0E-17
sp|Q3IF51|SYC_PSEHT Cysteine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysS PE=3 SV=1 21 99 4.0E-17
sp|B0UVH6|SYC_HISS2 Cysteine--tRNA ligase OS=Histophilus somni (strain 2336) GN=cysS PE=3 SV=1 18 99 4.0E-17
sp|Q1IBP9|SYC_PSEE4 Cysteine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=cysS PE=3 SV=1 18 122 5.0E-17
sp|B0KUU0|SYC_PSEPG Cysteine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=cysS PE=3 SV=1 18 122 5.0E-17
sp|Q5WLT3|SYC_BACSK Cysteine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=cysS PE=3 SV=1 18 98 6.0E-17
sp|Q7VMA0|SYC_HAEDU Cysteine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cysS PE=3 SV=1 18 100 6.0E-17
sp|B0S0W3|SYC_FINM2 Cysteine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=cysS PE=3 SV=1 19 120 6.0E-17
sp|B2UY90|SYC_CLOBA Cysteine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=cysS PE=3 SV=1 19 98 7.0E-17
sp|Q2SK40|SYC_HAHCH Cysteine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=cysS PE=3 SV=1 18 122 7.0E-17
sp|A5UFP3|SYC_HAEIG Cysteine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=cysS PE=3 SV=1 18 99 7.0E-17
sp|A5W458|SYC_PSEP1 Cysteine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysS PE=3 SV=1 18 122 7.0E-17
sp|Q88IU4|SYC_PSEPK Cysteine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=cysS PE=3 SV=1 18 122 7.0E-17
sp|B2SFH9|SYC_FRATM Cysteine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=cysS PE=3 SV=1 19 99 8.0E-17
sp|P57890|SYC_PASMU Cysteine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=cysS PE=3 SV=1 18 100 8.0E-17
sp|Q4QPG7|SYC_HAEI8 Cysteine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=cysS PE=3 SV=1 18 99 8.0E-17
sp|P43816|SYC_HAEIN Cysteine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysS PE=3 SV=1 18 99 8.0E-17
sp|B1J805|SYC_PSEPW Cysteine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=cysS PE=3 SV=1 18 122 8.0E-17
sp|O67163|SYC_AQUAE Cysteine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=cysS PE=3 SV=1 19 98 9.0E-17
sp|B4F1M6|SYC_PROMH Cysteine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=cysS PE=3 SV=1 18 100 9.0E-17
sp|B1XND1|SYC_SYNP2 Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysS PE=3 SV=1 19 122 9.0E-17
sp|Q81J59|SYC_BACCR Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysS PE=3 SV=1 18 124 1.0E-16
sp|B7HJ28|SYC_BACC4 Cysteine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=cysS PE=3 SV=1 18 124 1.0E-16
sp|B7ISZ9|SYC_BACC2 Cysteine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=cysS PE=3 SV=1 18 124 1.0E-16
sp|B9DKW3|SYC_STACT Cysteine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=cysS PE=3 SV=1 18 124 1.0E-16
sp|Q4K9S1|SYC_PSEF5 Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysS PE=3 SV=1 18 122 1.0E-16
sp|C3JYD3|SYC_PSEFS Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=cysS PE=3 SV=1 18 122 1.0E-16
sp|A6WLP8|SYC_SHEB8 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=cysS PE=3 SV=1 18 117 1.0E-16
sp|B8E5F2|SYC_SHEB2 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=cysS PE=3 SV=1 18 117 1.0E-16
sp|A9KWH4|SYC_SHEB9 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=cysS PE=3 SV=1 18 117 1.0E-16
sp|A3D302|SYC_SHEB5 Cysteine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysS PE=3 SV=1 18 117 1.0E-16
sp|Q3KA28|SYC_PSEPF Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysS PE=3 SV=1 18 122 1.0E-16
sp|B0JJL5|SYC_MICAN Cysteine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=cysS PE=3 SV=1 18 100 1.0E-16
sp|Q5QYP3|SYC_IDILO Cysteine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cysS PE=3 SV=1 19 99 1.0E-16
sp|Q2KAA8|SYC_RHIEC Cysteine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=cysS PE=3 SV=1 17 100 1.0E-16
sp|Q0I1Q1|SYC_HAES1 Cysteine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=cysS PE=3 SV=1 18 99 1.0E-16
sp|B2TIF6|SYC_CLOBB Cysteine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=cysS PE=3 SV=1 19 98 2.0E-16
sp|C1ET19|SYC_BACC3 Cysteine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|A0R8G1|SYC_BACAH Cysteine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|Q73FB7|SYC_BACC1 Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|B9IZH4|SYC_BACCQ Cysteine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|B7HQS4|SYC_BACC7 Cysteine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|A9VNA2|SYC_BACWK Cysteine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|B8GNT5|SYC_THISH Cysteine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A5WEW9|SYC_PSYWF Cysteine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=cysS PE=3 SV=1 3 99 2.0E-16
sp|Q92R20|SYC_RHIME Cysteine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=cysS PE=3 SV=1 17 206 2.0E-16
sp|A6U7D9|SYC_SINMW Cysteine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=cysS PE=3 SV=1 18 100 2.0E-16
sp|Q9I2U7|SYC_PSEAE Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7VB84|SYC_PSEA8 Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q02KT6|SYC_PSEAB Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A6V727|SYC_PSEA7 Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q12L98|SYC_SHEDO Cysteine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysS PE=3 SV=1 18 116 2.0E-16
sp|Q7N0S5|SYC_PHOLL Cysteine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B9JCA5|SYC_AGRRK Cysteine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysS PE=3 SV=1 16 100 2.0E-16
sp|Q38UZ6|SYC_LACSS Cysteine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=cysS PE=3 SV=1 18 124 2.0E-16
sp|Q60BG8|SYC_METCA Cysteine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7K7T8|SYC_CYAP7 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=cysS PE=3 SV=1 18 98 2.0E-16
sp|Q8ZR68|SYC_SALTY Cysteine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|C0PVI8|SYC_SALPC Cysteine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B5R6X0|SYC_SALG2 Cysteine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B5QUV0|SYC_SALEP Cysteine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|Q57S29|SYC_SALCH Cysteine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B5EYD7|SYC_SALA4 Cysteine--tRNA ligase OS=Salmonella agona (strain SL483) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|Q8Z8P6|SYC_SALTI Cysteine--tRNA ligase OS=Salmonella typhi GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B4TN59|SYC_SALSV Cysteine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B5BCZ8|SYC_SALPK Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|A9MW31|SYC_SALPB Cysteine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|Q5PCE2|SYC_SALPA Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B4SXP2|SYC_SALNS Cysteine--tRNA ligase OS=Salmonella newport (strain SL254) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B4TA89|SYC_SALHS Cysteine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|B5FLP7|SYC_SALDC Cysteine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|A9MLA7|SYC_SALAR Cysteine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysS PE=3 SV=1 18 144 2.0E-16
sp|Q984X8|SYC_RHILO Cysteine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=cysS PE=3 SV=1 19 111 2.0E-16
sp|Q473D3|SYC_CUPPJ Cysteine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q3Z4P5|SYC_SHISS Cysteine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A6T5R2|SYC_KLEP7 Cysteine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysS PE=3 SV=1 18 210 2.0E-16
sp|B5Y0K6|SYC_KLEP3 Cysteine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=cysS PE=3 SV=1 18 210 2.0E-16
sp|Q324Y3|SYC_SHIBS Cysteine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B1LKE5|SYC_ECOSM Cysteine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q0T776|SYC_SHIF8 Cysteine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysS PE=3 SV=2 18 99 2.0E-16
sp|Q1RF08|SYC_ECOUT Cysteine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B6I0H1|SYC_ECOSE Cysteine--tRNA ligase OS=Escherichia coli (strain SE11) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|P21888|SYC_ECOLI Cysteine--tRNA ligase OS=Escherichia coli (strain K12) GN=cysS PE=1 SV=2 18 116 2.0E-16
sp|B1IZ75|SYC_ECOLC Cysteine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q8FK44|SYC_ECOL6 Cysteine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A1A8J2|SYC_ECOK1 Cysteine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A7ZXI1|SYC_ECOHS Cysteine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B1XGC4|SYC_ECODH Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=cysS PE=3 SV=1 18 116 2.0E-16
sp|C4ZUX4|SYC_ECOBW Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysS PE=3 SV=1 18 116 2.0E-16
sp|B7M4M9|SYC_ECO8A Cysteine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7MRI9|SYC_ECO81 Cysteine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7NL20|SYC_ECO7I Cysteine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7L7F3|SYC_ECO55 Cysteine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|B7ME49|SYC_ECO45 Cysteine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A7ZIT5|SYC_ECO24 Cysteine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|Q2NV45|SYC_SODGM Cysteine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=cysS PE=3 SV=1 18 116 2.0E-16
sp|Q83M27|SYC_SHIFL Cysteine--tRNA ligase OS=Shigella flexneri GN=cysS PE=3 SV=1 18 99 2.0E-16
sp|A4J0Y9|SYC_DESRM Cysteine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=cysS PE=3 SV=1 19 119 3.0E-16
sp|C4Z3N5|SYC_EUBE2 Cysteine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=cysS PE=3 SV=1 19 98 3.0E-16
sp|Q1MJ22|SYC_RHIL3 Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=cysS PE=3 SV=1 17 100 3.0E-16
sp|A4XVG1|SYC_PSEMY Cysteine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=cysS PE=3 SV=1 19 99 3.0E-16
sp|B5ZWB3|SYC_RHILW Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=cysS PE=3 SV=1 17 100 3.0E-16
sp|B7N980|SYC_ECOLU Cysteine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysS PE=3 SV=1 18 99 3.0E-16
sp|B2U9P8|SYC_RALPJ Cysteine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=cysS PE=3 SV=1 19 99 3.0E-16
sp|B7UKK3|SYC_ECO27 Cysteine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysS PE=3 SV=1 18 99 3.0E-16
sp|B2TTB3|SYC_SHIB3 Cysteine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysS PE=3 SV=1 18 99 3.0E-16
sp|B5YPP1|SYC_ECO5E Cysteine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysS PE=3 SV=1 18 99 3.0E-16
sp|Q8XCT9|SYC_ECO57 Cysteine--tRNA ligase OS=Escherichia coli O157:H7 GN=cysS PE=3 SV=1 18 99 3.0E-16
sp|B1HNM3|SYC_LYSSC Cysteine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=cysS PE=3 SV=1 19 125 4.0E-16
sp|Q6HPS8|SYC_BACHK Cysteine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|Q63HB0|SYC_BACCZ Cysteine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|B7JK97|SYC_BACC0 Cysteine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|Q81VV1|SYC_BACAN Cysteine--tRNA ligase OS=Bacillus anthracis GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|C3LJ62|SYC_BACAC Cysteine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|C3P9N5|SYC_BACAA Cysteine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=cysS PE=3 SV=1 18 124 4.0E-16
sp|F4IPY2|SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYCO PE=2 SV=1 19 98 4.0E-16
sp|B0TC35|SYC_HELMI Cysteine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=cysS PE=3 SV=1 19 98 4.0E-16
sp|B0U0I3|SYC_FRAP2 Cysteine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=cysS PE=3 SV=1 19 99 4.0E-16
sp|Q03ZR0|SYC_LEUMM Cysteine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=cysS PE=3 SV=1 18 103 4.0E-16
sp|Q13X60|SYC_BURXL Cysteine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=cysS PE=3 SV=1 19 99 4.0E-16
sp|A8AB68|SYC_IGNH4 Cysteine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=cysS PE=3 SV=1 18 98 4.0E-16
sp|Q839V5|SYC_ENTFA Cysteine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cysS PE=3 SV=1 18 112 4.0E-16
sp|A7GK01|SYC_BACCN Cysteine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cysS PE=3 SV=1 18 98 5.0E-16
sp|A6LPP1|SYC_CLOB8 Cysteine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=cysS PE=3 SV=1 19 96 5.0E-16
sp|A5IBG0|SYC_LEGPC Cysteine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=cysS PE=3 SV=1 18 98 5.0E-16
sp|Q5WX29|SYC_LEGPL Cysteine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=cysS PE=3 SV=1 18 98 5.0E-16
sp|Q045X8|SYC_LACGA Cysteine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=cysS PE=3 SV=1 18 115 5.0E-16
sp|Q5ZVY1|SYC_LEGPH Cysteine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cysS PE=3 SV=1 18 98 5.0E-16
sp|Q5X5P9|SYC_LEGPA Cysteine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=cysS PE=3 SV=1 18 98 5.0E-16
sp|Q7VB63|SYC_PROMA Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysS PE=3 SV=1 19 110 5.0E-16
sp|Q97ED6|SYC_CLOAB Cysteine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysS PE=3 SV=1 19 96 6.0E-16
sp|C3KVS3|SYC_CLOB6 Cysteine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=cysS PE=3 SV=1 21 98 6.0E-16
sp|P0DG33|SYC_STRPQ Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cysS PE=3 SV=1 18 98 6.0E-16
sp|P0DG32|SYC_STRP3 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cysS PE=3 SV=1 18 98 6.0E-16
sp|A8F962|SYC_BACP2 Cysteine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=cysS PE=3 SV=1 21 98 6.0E-16
sp|A8GAY0|SYC_SERP5 Cysteine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=cysS PE=3 SV=1 18 99 6.0E-16
sp|A6SZV1|SYC_JANMA Cysteine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=cysS PE=3 SV=1 19 122 6.0E-16
sp|Q74L26|SYC_LACJO Cysteine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=cysS PE=3 SV=1 19 115 6.0E-16
sp|Q8Y077|SYC_RALSO Cysteine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=cysS PE=3 SV=1 19 99 6.0E-16
sp|Q890M4|SYC_CLOTE Cysteine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=cysS PE=3 SV=1 21 96 7.0E-16
sp|A6VX53|SYC_MARMS Cysteine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=cysS PE=3 SV=1 18 100 8.0E-16
sp|Q88YX9|SYC_LACPL Cysteine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysS PE=3 SV=1 18 133 8.0E-16
sp|Q47HK6|SYC_DECAR Cysteine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=cysS PE=3 SV=1 18 99 8.0E-16
sp|B9MMM6|SYC_CALBD Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 21 98 9.0E-16
sp|A4XHE2|SYC_CALS8 Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 21 98 9.0E-16
sp|C1D7F5|SYC_LARHH Cysteine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=cysS PE=3 SV=1 18 122 9.0E-16
sp|C4KZR7|SYC_EXISA Cysteine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=cysS PE=3 SV=1 18 122 1.0E-15
sp|B1KTA5|SYC_CLOBM Cysteine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=cysS PE=3 SV=1 21 98 1.0E-15
sp|Q48RA7|SYC_STRPM Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|Q8NZD1|SYC_STRP8 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|A1U1Q7|SYC_MARHV Cysteine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysS PE=3 SV=1 19 99 1.0E-15
sp|Q5X9W5|SYC_STRP6 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|Q99XZ9|SYC_STRP1 Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|Q31H54|SYC_THICR Cysteine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysS PE=3 SV=1 19 122 1.0E-15
sp|Q1QVV6|SYC_CHRSD Cysteine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysS PE=3 SV=1 19 99 1.0E-15
sp|A7MK00|SYC_CROS8 Cysteine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysS PE=3 SV=2 18 116 1.0E-15
sp|Q8ETZ9|SYC_OCEIH Cysteine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysS PE=3 SV=1 19 97 1.0E-15
sp|Q4FRZ9|SYC_PSYA2 Cysteine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=cysS PE=3 SV=1 19 122 1.0E-15
sp|Q3J8Y9|SYC_NITOC Cysteine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysS PE=3 SV=1 18 122 1.0E-15
sp|A2BXK1|SYC_PROM5 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|Q2SX78|SYC_BURTA Cysteine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cysS PE=3 SV=1 19 99 1.0E-15
sp|Q74MI1|SYC_NANEQ Cysteine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=cysS PE=3 SV=1 18 98 1.0E-15
sp|C5B8V6|SYC_EDWI9 Cysteine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=cysS PE=3 SV=1 18 99 1.0E-15
sp|Q82Y45|SYC_NITEU Cysteine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysS PE=3 SV=1 18 100 1.0E-15
sp|Q0KCA9|SYC_CUPNH Cysteine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cysS PE=3 SV=1 18 99 1.0E-15
sp|Q39ZL8|SYC_GEOMG Cysteine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cysS PE=3 SV=1 19 108 2.0E-15
sp|Q06752|SYC_BACSU Cysteine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=cysS PE=1 SV=1 21 98 2.0E-15
sp|A5G949|SYC_GEOUR Cysteine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=cysS PE=3 SV=1 19 98 2.0E-15
sp|A5N4M6|SYC_CLOK5 Cysteine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysS PE=3 SV=1 19 101 2.0E-15
sp|B9DY88|SYC_CLOK1 Cysteine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=cysS PE=3 SV=1 19 101 2.0E-15
sp|A7Z0L6|SYC_BACMF Cysteine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysS PE=3 SV=1 21 98 2.0E-15
sp|B9LZV4|SYC_GEODF Cysteine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysS PE=3 SV=1 19 108 2.0E-15
sp|B1YGS9|SYC_EXIS2 Cysteine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=cysS PE=3 SV=1 18 118 2.0E-15
sp|A4VL73|SYC_PSEU5 Cysteine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=cysS PE=3 SV=2 19 99 2.0E-15
sp|B1JHJ1|SYC_YERPY Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|A4TP63|SYC_YERPP Cysteine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q1CKY1|SYC_YERPN Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|A9R253|SYC_YERPG Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q8ZCC0|SYC_YERPE Cysteine--tRNA ligase OS=Yersinia pestis GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q1C4U1|SYC_YERPA Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|A7FL46|SYC_YERP3 Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q66DK9|SYC_YERPS Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|B2K7N2|SYC_YERPB Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q8PVQ1|SYC_METMA Cysteine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cysS PE=3 SV=1 18 97 2.0E-15
sp|A1JNP9|SYC_YERE8 Cysteine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|A1S4X2|SYC_SHEAM Cysteine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysS PE=3 SV=1 18 99 2.0E-15
sp|A4G4M2|SYC_HERAR Cysteine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|Q03E41|SYC_PEDPA Cysteine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=cysS PE=3 SV=1 18 124 2.0E-15
sp|Q7V0W1|SYC_PROMP Cysteine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cysS PE=3 SV=1 18 110 2.0E-15
sp|B3R4D1|SYC_CUPTR Cysteine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A9AHN6|SYC_BURM1 Cysteine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=cysS PE=3 SV=1 19 122 2.0E-15
sp|B1YSM8|SYC_BURA4 Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|Q63SS8|SYC_BURPS Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A3NB50|SYC_BURP6 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|Q3JQT6|SYC_BURP1 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A3NWX8|SYC_BURP0 Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A1V5G8|SYC_BURMS Cysteine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|Q62J37|SYC_BURMA Cysteine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A2SAX8|SYC_BURM9 Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|A3ML43|SYC_BURM7 Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=cysS PE=3 SV=1 19 99 2.0E-15
sp|Q0AJJ4|SYC_NITEC Cysteine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=cysS PE=3 SV=1 18 100 2.0E-15
sp|Q9JXE6|SYC_NEIMB Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysS PE=3 SV=1 21 99 2.0E-15
sp|Q8XHQ5|SYC_CLOPE Cysteine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=cysS PE=3 SV=1 18 98 3.0E-15
sp|Q0SQC1|SYC_CLOPS Cysteine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=cysS PE=3 SV=1 18 101 3.0E-15
sp|Q0TMM4|SYC_CLOP1 Cysteine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=cysS PE=3 SV=1 18 98 3.0E-15
sp|Q65PC8|SYC_BACLD Cysteine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysS PE=3 SV=1 18 98 3.0E-15
sp|A0AF38|SYC_LISW6 Cysteine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cysS PE=3 SV=1 19 148 3.0E-15
sp|C1FMX3|SYC_CLOBJ Cysteine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|B1IGH6|SYC_CLOBK Cysteine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|A7GJ96|SYC_CLOBL Cysteine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|A5I7M8|SYC_CLOBH Cysteine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|A7FZ91|SYC_CLOB1 Cysteine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|Q83BL7|SYC_COXBU Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cysS PE=1 SV=2 21 99 3.0E-15
sp|A9KBJ2|SYC_COXBN Cysteine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cysS PE=3 SV=1 19 99 3.0E-15
sp|A9N924|SYC_COXBR Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cysS PE=3 SV=1 19 99 3.0E-15
sp|B7GJ46|SYC_ANOFW Cysteine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysS PE=3 SV=1 21 98 3.0E-15
sp|B4U9I4|SYC_HYDS0 Cysteine--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=cysS PE=3 SV=1 21 110 3.0E-15
sp|Q9YBK6|SYC_AERPE Cysteine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysS PE=3 SV=2 18 98 3.0E-15
sp|B7JUH4|SYC_CYAP8 Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=cysS PE=3 SV=1 18 98 3.0E-15
sp|Q21JG6|SYC_SACD2 Cysteine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysS PE=3 SV=1 19 99 3.0E-15
sp|B4ED73|SYC_BURCJ Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cysS PE=3 SV=1 19 99 3.0E-15
sp|Q39EY8|SYC2_BURL3 Cysteine--tRNA ligase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cysS2 PE=3 SV=1 19 99 3.0E-15
sp|B1JUK8|SYC_BURCC Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=cysS PE=3 SV=1 19 99 3.0E-15
sp|A1WT89|SYC_HALHL Cysteine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysS PE=3 SV=1 18 99 3.0E-15
sp|Q8E7F2|SYC_STRA3 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cysS PE=3 SV=1 18 98 4.0E-15
sp|Q97S25|SYC_STRPN Cysteine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cysS PE=3 SV=1 18 112 4.0E-15
sp|Q8DQS8|SYC_STRR6 Cysteine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cysS PE=3 SV=1 18 112 4.0E-15
sp|Q8CTU1|SYC_STAES Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysS PE=3 SV=1 18 124 4.0E-15
sp|Q5HRM3|SYC_STAEQ Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysS PE=3 SV=1 18 124 4.0E-15
sp|Q04DQ8|SYC_OENOB Cysteine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=cysS PE=3 SV=1 18 104 4.0E-15
sp|Q4L3I9|SYC_STAHJ Cysteine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysS PE=3 SV=1 18 124 4.0E-15
sp|Q49V39|SYC_STAS1 Cysteine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysS PE=3 SV=1 18 98 4.0E-15
sp|Q1H417|SYC_METFK Cysteine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysS PE=3 SV=1 18 99 4.0E-15
sp|B5YID4|SYC_THEYD Cysteine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysS PE=3 SV=1 19 98 4.0E-15
sp|Q250Q6|SYC_DESHY Cysteine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=cysS PE=3 SV=1 18 98 4.0E-15
sp|B8G1U2|SYC_DESHD Cysteine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=cysS PE=3 SV=1 18 98 4.0E-15
sp|B2IEE1|SYC_BEII9 Cysteine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=cysS PE=3 SV=1 19 98 4.0E-15
sp|A4JFD0|SYC_BURVG Cysteine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cysS PE=3 SV=1 19 99 4.0E-15
sp|A0K8K2|SYC_BURCH Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=cysS PE=3 SV=1 19 99 4.0E-15
sp|Q1BHP1|SYC_BURCA Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=cysS PE=3 SV=1 19 99 4.0E-15
sp|P74330|SYC_SYNY3 Cysteine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysS PE=3 SV=1 18 96 4.0E-15
sp|Q8YXW5|SYC_NOSS1 Cysteine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysS PE=3 SV=1 18 101 4.0E-15
sp|Q3K3G5|SYC_STRA1 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=cysS PE=3 SV=1 18 98 5.0E-15
sp|Q8E1Z4|SYC_STRA5 Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=cysS PE=3 SV=1 18 98 5.0E-15
sp|B4U570|SYC_STREM Cysteine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=cysS PE=3 SV=1 18 101 5.0E-15
sp|Q6FC71|SYC_ACIAD Cysteine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysS PE=3 SV=1 21 100 6.0E-15
sp|Q6GJD9|SYC_STAAR Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=cysS PE=3 SV=1 18 124 6.0E-15
sp|Q2YSD1|SYC_STAAB Cysteine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cysS PE=3 SV=1 18 124 6.0E-15
sp|Q1WSS5|SYC_LACS1 Cysteine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=cysS PE=3 SV=1 18 101 6.0E-15
sp|Q1QC19|SYC_PSYCK Cysteine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=cysS PE=3 SV=1 1 99 6.0E-15
sp|Q3M6R3|SYC_ANAVT Cysteine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=cysS PE=3 SV=1 18 98 6.0E-15
sp|A1AK01|SYC_PELPD Cysteine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=cysS PE=3 SV=1 19 98 7.0E-15
sp|Q3A9P1|SYC_CARHZ Cysteine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=cysS PE=3 SV=1 21 106 7.0E-15
sp|C1DHE6|SYC_AZOVD Cysteine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysS PE=3 SV=1 18 99 7.0E-15
sp|B1MW68|SYC_LEUCK Cysteine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=cysS PE=3 SV=1 18 98 7.0E-15
sp|Q46BZ5|SYC_METBF Cysteine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=cysS PE=3 SV=1 18 97 7.0E-15
sp|A6UWT0|SYC_META3 Cysteine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=cysS PE=3 SV=1 21 98 8.0E-15
sp|A4IJG8|SYC_GEOTN Cysteine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysS PE=3 SV=1 21 98 8.0E-15
sp|C6E7P0|SYC_GEOSM Cysteine--tRNA ligase OS=Geobacter sp. (strain M21) GN=cysS PE=3 SV=1 19 108 8.0E-15
sp|Q5L429|SYC_GEOKA Cysteine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=cysS PE=3 SV=1 21 98 8.0E-15
sp|B0VS71|SYC_ACIBS Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=cysS PE=3 SV=1 21 99 8.0E-15
sp|Q0BDV4|SYC_BURCM Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysS PE=3 SV=1 19 99 8.0E-15
sp|A8YZM7|SYC_STAAT Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cysS PE=3 SV=2 18 124 9.0E-15
sp|A6QEI2|SYC_STAAE Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q5HIE5|SYC_STAAC Cysteine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q2G2M6|SYC_STAA8 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q2FJB0|SYC_STAA3 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q99W73|SYC_STAAN Cysteine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=cysS PE=1 SV=1 18 124 9.0E-15
sp|Q932G0|SYC_STAAM Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysS PE=3 SV=2 18 124 9.0E-15
sp|A5IQ83|SYC_STAA9 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|A6TZ06|SYC_STAA2 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|A7WYU7|SYC_STAA1 Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q8NXY7|SYC_STAAW Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|Q6GBV8|SYC_STAAS Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=cysS PE=3 SV=1 18 124 9.0E-15
sp|A3M419|SYC_ACIBT Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cysS PE=3 SV=2 21 99 9.0E-15
sp|B2HX34|SYC_ACIBC Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=cysS PE=3 SV=1 21 99 9.0E-15
sp|B0VAU1|SYC_ACIBY Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=cysS PE=3 SV=1 21 99 9.0E-15
sp|B7IBU3|SYC_ACIB5 Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=cysS PE=3 SV=1 21 99 9.0E-15
sp|B7GWA1|SYC_ACIB3 Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=cysS PE=3 SV=1 21 99 9.0E-15
sp|Q8YAB1|SYC_LISMO Cysteine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cysS PE=3 SV=1 19 159 1.0E-14
sp|B5EEK6|SYC_GEOBB Cysteine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=cysS PE=3 SV=1 19 108 1.0E-14
sp|Q747A2|SYC_GEOSL Cysteine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=cysS PE=3 SV=1 19 108 1.0E-14
sp|Q72BQ5|SYC_DESVH Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=cysS PE=3 SV=1 19 122 1.0E-14
sp|Q8TSP6|SYC_METAC Cysteine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cysS PE=3 SV=1 18 93 1.0E-14
sp|A1VDQ5|SYC_DESVV Cysteine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=cysS PE=3 SV=1 19 122 1.0E-14
sp|B6JHT8|SYC_OLICO Cysteine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysS PE=3 SV=1 19 100 1.0E-14
sp|Q2Y7U5|SYC_NITMU Cysteine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=cysS PE=3 SV=1 18 99 1.0E-14
sp|Q8UGG4|SYC_AGRFC Cysteine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysS PE=3 SV=1 19 100 1.0E-14
sp|Q1QN87|SYC_NITHX Cysteine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysS PE=3 SV=1 19 99 1.0E-14
sp|A0PXS5|SYC_CLONN Cysteine--tRNA ligase OS=Clostridium novyi (strain NT) GN=cysS PE=3 SV=1 21 101 2.0E-14
sp|B8DF15|SYC_LISMH Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cysS PE=3 SV=1 19 124 2.0E-14
sp|Q724H3|SYC_LISMF Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cysS PE=3 SV=1 19 124 2.0E-14
sp|C1KYH2|SYC_LISMC Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cysS PE=3 SV=1 19 124 2.0E-14
sp|Q92F36|SYC_LISIN Cysteine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cysS PE=3 SV=1 19 124 2.0E-14
sp|A9BGT9|SYC_PETMO Cysteine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=cysS PE=3 SV=1 17 101 2.0E-14
sp|Q2IQG7|SYC_ANADE Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=cysS PE=3 SV=1 19 98 2.0E-14
sp|B8JDH1|SYC_ANAD2 Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=cysS PE=3 SV=1 19 98 2.0E-14
sp|B4UGC3|SYC_ANASK Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=cysS PE=3 SV=1 19 98 2.0E-14
sp|A3PDX8|SYC_PROM0 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=cysS PE=3 SV=1 18 112 2.0E-14
sp|Q7VRB4|SYC_BLOFL Cysteine--tRNA ligase OS=Blochmannia floridanus GN=cysS PE=3 SV=1 18 99 2.0E-14
sp|Q5M6F6|SYC_STRT2 Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cysS PE=3 SV=1 18 98 3.0E-14
sp|Q5M1W6|SYC_STRT1 Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cysS PE=3 SV=1 18 98 3.0E-14
sp|B2GAB5|SYC_LACF3 Cysteine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cysS PE=3 SV=1 18 124 3.0E-14
sp|A7HDA1|SYC_ANADF Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=cysS PE=3 SV=1 19 98 3.0E-14
sp|C4XSW5|SYC_DESMR Cysteine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=cysS PE=3 SV=1 19 96 3.0E-14
sp|B8DKL0|SYC_DESVM Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=cysS PE=3 SV=1 19 101 3.0E-14
sp|A5EHE7|SYC_BRASB Cysteine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=cysS PE=3 SV=1 19 99 3.0E-14
sp|A8G5S9|SYC_PROM2 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=cysS PE=3 SV=1 18 98 3.0E-14
sp|Q8DWA9|SYC_STRMU Cysteine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cysS PE=3 SV=1 18 112 4.0E-14
sp|C5D3P6|SYC_GEOSW Cysteine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=cysS PE=3 SV=1 21 98 4.0E-14
sp|B6ISG4|SYC_RHOCS Cysteine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=cysS PE=3 SV=1 18 99 4.0E-14
sp|Q7NX82|SYC_CHRVO Cysteine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysS PE=3 SV=2 18 96 4.0E-14
sp|A2BS39|SYC_PROMS Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=cysS PE=3 SV=1 18 98 4.0E-14
sp|A4WH15|SYC_PYRAR Cysteine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=cysS PE=3 SV=1 21 106 4.0E-14
sp|Q3A8C9|SYC_PELCD Cysteine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=cysS PE=3 SV=1 19 98 5.0E-14
sp|A5D5M0|SYC_PELTS Cysteine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=cysS PE=3 SV=1 21 98 5.0E-14
sp|B3E1P0|SYC_GEOLS Cysteine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=cysS PE=3 SV=1 19 98 5.0E-14
sp|Q3ZWG4|SYC_DEHMC Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=cysS PE=3 SV=1 21 110 5.0E-14
sp|B9KAQ8|SYC_THENN Cysteine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=cysS PE=3 SV=1 21 98 5.0E-14
sp|A0L4P8|SYC_MAGMM Cysteine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=cysS PE=3 SV=1 19 119 5.0E-14
sp|C5BI15|SYC_TERTT Cysteine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysS PE=3 SV=1 19 135 5.0E-14
sp|Q319Z9|SYC_PROM9 Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=cysS PE=3 SV=1 18 98 5.0E-14
sp|B1L7Y7|SYC_THESQ Cysteine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=cysS PE=3 SV=1 21 115 6.0E-14
sp|A5IJ66|SYC_THEP1 Cysteine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=cysS PE=3 SV=1 21 115 6.0E-14
sp|Q5FM34|SYC_LACAC Cysteine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=cysS PE=3 SV=1 21 129 6.0E-14
sp|B3WA35|SYC_LACCB Cysteine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=cysS PE=3 SV=1 18 115 6.0E-14
sp|Q035S0|SYC_LACC3 Cysteine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=cysS PE=3 SV=2 18 115 6.0E-14
sp|B8J0S2|SYC_DESDA Cysteine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=cysS PE=3 SV=1 19 101 7.0E-14
sp|B2G5S5|SYC_LACRJ Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=cysS PE=3 SV=1 18 129 9.0E-14
sp|A5VI99|SYC_LACRD Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=cysS PE=3 SV=1 18 129 9.0E-14
sp|A8YTD3|SYC_LACH4 Cysteine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=cysS PE=3 SV=1 21 129 9.0E-14
sp|Q3STA1|SYC_NITWN Cysteine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysS PE=3 SV=1 19 99 9.0E-14
sp|Q9WZH8|SYC_THEMA Cysteine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cysS PE=3 SV=1 21 115 1.0E-13
sp|Q2JTF4|SYC_SYNJA Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysS PE=3 SV=1 18 96 1.0E-13
sp|A5FP90|SYC_DEHMB Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=cysS PE=3 SV=1 21 110 2.0E-13
sp|Q3ZAD5|SYC_DEHM1 Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=cysS PE=3 SV=1 21 110 2.0E-13
sp|Q6AJ23|SYC_DESPS Cysteine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=cysS PE=3 SV=1 21 98 2.0E-13
sp|B1I0T1|SYC_DESAP Cysteine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=cysS PE=3 SV=1 19 129 2.0E-13
sp|Q8KAK2|SYC_CHLTE Cysteine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=cysS PE=3 SV=1 19 101 3.0E-13
sp|Q02WZ9|SYC_LACLS Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=cysS PE=3 SV=1 21 215 3.0E-13
sp|Q9HJ27|SYC_THEAC Cysteine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=cysS PE=3 SV=1 22 101 3.0E-13
sp|Q03SU6|SYC_LACBA Cysteine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cysS PE=3 SV=1 18 115 3.0E-13
sp|Q048S9|SYC_LACDB Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=cysS PE=3 SV=1 19 96 4.0E-13
sp|Q1G8Z0|SYC_LACDA Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=cysS PE=3 SV=1 19 96 4.0E-13
sp|C4LH17|SYC_CORK4 Cysteine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=cysS PE=3 SV=1 18 100 4.0E-13
sp|A4YIG5|SYC_METS5 Cysteine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=cysS PE=3 SV=1 19 98 5.0E-13
sp|A2RMS1|SYC_LACLM Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=cysS PE=3 SV=1 21 215 5.0E-13
sp|A1RTJ7|SYC_PYRIL Cysteine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=cysS PE=3 SV=1 21 106 5.0E-13
sp|Q8RIK9|SYC_FUSNN Cysteine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cysS PE=3 SV=1 18 96 6.0E-13
sp|Q5V2M3|SYC_HALMA Cysteine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cysS PE=3 SV=1 18 99 6.0E-13
sp|Q0AM03|SYC_MARMM Cysteine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=cysS PE=3 SV=1 19 112 6.0E-13
sp|C0ZIF7|SYC_BREBN Cysteine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysS PE=3 SV=1 23 98 8.0E-13
sp|B1YA45|SYC_PYRNV Cysteine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=cysS PE=3 SV=1 21 106 8.0E-13
sp|Q2JKL2|SYC_SYNJB Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysS PE=3 SV=1 19 96 8.0E-13
sp|Q0BXB7|SYC_HYPNA Cysteine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=cysS PE=3 SV=1 18 94 1.0E-12
sp|Q6DJ95|SYCM_XENTR Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=cars2 PE=2 SV=1 21 98 2.0E-12
sp|Q9CEJ0|SYC_LACLA Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=cysS PE=3 SV=1 19 101 2.0E-12
sp|Q3APK6|SYC_CHLCH Cysteine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=cysS PE=3 SV=1 19 97 2.0E-12
sp|A3Q6W0|SYC_MYCSJ Cysteine--tRNA ligase OS=Mycobacterium sp. (strain JLS) GN=cysS PE=3 SV=1 1 96 2.0E-12
sp|Q1B2P3|SYC_MYCSS Cysteine--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=cysS PE=3 SV=1 1 96 2.0E-12
sp|A1UMF5|SYC_MYCSK Cysteine--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=cysS PE=3 SV=1 1 96 2.0E-12
sp|Q9AAY2|SYC_CAUCR Cysteine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysS PE=3 SV=1 19 96 2.0E-12
sp|Q978Z5|SYC_THEVO Cysteine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=cysS PE=3 SV=2 19 98 3.0E-12
sp|A3MS54|SYC_PYRCJ Cysteine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=cysS PE=3 SV=1 21 106 3.0E-12
sp|Q8ZYD8|SYC_PYRAE Cysteine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cysS PE=3 SV=1 21 98 3.0E-12
sp|A0R558|SYC_MYCS2 Cysteine--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=cysS PE=3 SV=1 19 96 3.0E-12
sp|A4QH41|SYC_CORGB Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain R) GN=cysS PE=3 SV=1 18 99 6.0E-12
sp|Q8NMD7|SYC_CORGL Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cysS PE=3 SV=1 18 99 6.0E-12
sp|Q97WE6|SYC_SULSO Cysteine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cysS PE=3 SV=1 21 116 7.0E-12
sp|B1GYT2|SYC_UNCTG Cysteine--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=cysS PE=3 SV=1 21 101 8.0E-12
sp|Q8FMI8|SYC_COREF Cysteine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cysS PE=3 SV=2 19 99 1.0E-11
sp|A0PV27|SYC_MYCUA Cysteine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=cysS PE=3 SV=1 15 96 1.0E-11
sp|B2HJ21|SYC_MYCMM Cysteine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=cysS PE=3 SV=1 15 96 1.0E-11
sp|Q96YC3|SYC_SULTO Cysteine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cysS PE=3 SV=2 21 99 2.0E-11
sp|A7HKV1|SYC_FERNB Cysteine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=cysS PE=3 SV=1 19 98 2.0E-11
sp|Q47TG4|SYC_THEFY Cysteine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=cysS PE=3 SV=1 19 96 2.0E-11
sp|P57990|SYC_MYCLE Cysteine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=cysS PE=3 SV=1 19 96 2.0E-11
sp|B8ZUA9|SYC_MYCLB Cysteine--tRNA ligase OS=Mycobacterium leprae (strain Br4923) GN=cysS PE=3 SV=1 19 96 2.0E-11
sp|Q5UP36|SYC_MIMIV Cysteine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=CARS PE=3 SV=1 41 97 3.0E-11
sp|A7HWJ0|SYC_PARL1 Cysteine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=cysS PE=3 SV=1 13 98 3.0E-11
sp|Q5HUZ0|SYC_CAMJR Cysteine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=cysS PE=3 SV=1 21 99 4.0E-11
sp|A1VZF0|SYC_CAMJJ Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=cysS PE=3 SV=1 21 99 4.0E-11
sp|Q6MKR7|SYC_BDEBA Cysteine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=cysS PE=3 SV=1 18 98 5.0E-11
sp|Q9PPB8|SYC_CAMJE Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cysS PE=3 SV=1 21 99 5.0E-11
sp|Q4JCA6|SYC_SULAC Cysteine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cysS PE=3 SV=1 19 99 6.0E-11
sp|Q0VML5|SYC_ALCBS Cysteine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysS PE=3 SV=1 18 117 6.0E-11
sp|Q6NFC3|SYC_CORDI Cysteine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=cysS PE=3 SV=1 18 99 8.0E-11
sp|P9WFW0|SYC_MYCTO Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysS PE=3 SV=1 19 96 9.0E-11
sp|B7IFB7|SYC_THEAB Cysteine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=cysS PE=3 SV=1 19 98 1.0E-10
sp|P9WFW1|SYC_MYCTU Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysS PE=1 SV=1 19 96 1.0E-10
sp|A5U8Q5|SYC_MYCTA Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cysS PE=3 SV=1 19 96 1.0E-10
sp|C1AI39|SYC_MYCBT Cysteine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=cysS PE=3 SV=1 19 96 1.0E-10
sp|A1KPR6|SYC_MYCBP Cysteine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=cysS PE=3 SV=1 19 96 1.0E-10
sp|P0A635|SYC_MYCBO Cysteine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysS PE=3 SV=1 19 96 1.0E-10
sp|Q82GD0|SYC_STRAW Cysteine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cysS PE=3 SV=1 18 96 1.0E-10
sp|A4F6W7|SYC_SACEN Cysteine--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=cysS PE=3 SV=2 19 96 1.0E-10
sp|A8F596|SYC_PSELT Cysteine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=cysS PE=3 SV=1 22 96 2.0E-10
sp|Q9HQL9|SYC_HALSA Cysteine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cysS PE=1 SV=1 20 118 2.0E-10
sp|A8FLL5|SYC_CAMJ8 Cysteine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=cysS PE=3 SV=1 33 99 2.0E-10
sp|Q5Z2R1|SYC_NOCFA Cysteine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=cysS PE=3 SV=1 18 98 8.0E-10
sp|Q3BSH9|SYC_XANC5 Cysteine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysS PE=3 SV=1 19 97 2.0E-09
sp|Q5GZD9|SYC_XANOR Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysS PE=3 SV=1 19 97 2.0E-09
sp|Q2P2E8|SYC_XANOM Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysS PE=3 SV=1 19 97 2.0E-09
sp|Q8P8J0|SYC_XANCP Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysS PE=3 SV=1 19 97 2.0E-09
sp|Q4UVJ3|SYC_XANC8 Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysS PE=3 SV=1 19 97 2.0E-09
sp|Q8PK23|SYC_XANAC Cysteine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysS PE=3 SV=1 19 97 3.0E-09
sp|Q87EL7|SYC_XYLFT Cysteine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysS PE=3 SV=2 19 99 4.0E-08
sp|Q9PEN3|SYC_XYLFA Cysteine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=cysS PE=3 SV=2 19 99 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041940
MTTQPPWSLPKQQPEEPVLYVYNSLTRTKTKFVPTNERHVKWYNCGPTVYDASHLGHARNYVTQDILRRVMTDYF
GYDVHFVMNITDIDDKIISRARQNHLIENFRSESNALTPELVDTVFEAWTIHVRDKVNKGLPSDQKVVEGSEEAS
WPKLSVLIQSPEWKQECLKRDEKFDMHFTAANRCLLAIRNARDQMQSGVKSVDEAHNLIDESKDILARTLDAKYK
STVTDPNISRSLASYWETKFFEDMARLNVREPDTVTRVTEFIPEIVDFIKRIMDNGFAYESEGSVYFNTIKFDNA
DDHDYAKLEPWSKGNRELLEDGEGSLANKTGRRSASDFALWKASKPGEPSWPSFWGPGRPGWHIECSVMASAIFG
DNMDIHSGGIDLAFPHHDNEMAQSEAYHNCRAWVNYFWHTGHLHIEGLKMSKSLKNFITIDEILRKYTARQLRLA
FLTQLWNAKVDFSESLMTGEVRNIEITMNNFFTVVKALVNQHRSDAIRSDGFHHYEALEQDLTKSFYEAQSAFRS
ALSDSFDTPVALNALRELVSKTNIYINSRGKHLNVALVENIARWVGQMLRMFGLGEGEKVEPGWGQADQGVGNIN
REEVLTPYLRALSSFRDGVRQLAIAKNDTALKDILALCDKLRDVDLVPLGVALDDQDDGKALVKLVPPAELIKAR
DEKRAQQDAKASKKAASIEEERRKRIAKLEKGRTPPQDMFRNCPGYGSLDDEGIPRTDAEGKELSKNQAKKVQKQ
WQEQEKLHKAYLEWQKTLSP*
Coding >AgabiH97|041940
ATGACCACGCAGCCCCCTTGGTCGCTGCCAAAACAACAGCCGGAAGAACCTGTTCTTTATGTCTACAATTCGTTG
ACCAGAACTAAAACAAAATTTGTTCCGACCAACGAGCGTCACGTCAAATGGTACAACTGCGGTCCTACGGTTTAT
GACGCCTCACACTTGGGTCATGCAAGAAACTACGTCACACAGGATATTCTCCGCCGGGTAATGACTGATTATTTC
GGTTACGACGTGCATTTTGTTATGAATATCACGGATATCGATGATAAAATAATCTCTCGCGCTCGCCAAAATCAC
CTCATTGAGAACTTCCGATCTGAGAGTAACGCTCTTACTCCTGAACTAGTGGACACCGTCTTCGAAGCTTGGACG
ATCCATGTCAGAGACAAAGTAAATAAAGGATTACCAAGTGATCAGAAGGTAGTTGAGGGATCTGAAGAGGCAAGC
TGGCCAAAATTATCTGTTCTGATACAGAGCCCGGAATGGAAGCAAGAGTGCTTGAAACGCGACGAAAAGTTCGAT
ATGCACTTCACAGCAGCTAATCGCTGCTTATTGGCCATTCGAAACGCAAGAGACCAAATGCAATCTGGCGTTAAA
TCCGTGGATGAAGCTCATAATTTGATTGACGAGTCTAAGGATATTTTGGCTCGGACATTAGACGCAAAGTATAAA
TCTACGGTCACTGACCCTAACATATCTCGATCCCTTGCTTCCTATTGGGAAACCAAATTCTTCGAAGATATGGCC
CGCCTTAACGTTCGAGAGCCTGATACAGTTACTCGCGTCACAGAATTTATACCCGAAATTGTTGATTTCATAAAG
CGCATCATGGATAATGGTTTCGCATACGAATCGGAAGGCAGCGTGTATTTCAACACCATCAAGTTTGATAATGCG
GATGACCATGATTATGCGAAACTCGAGCCGTGGAGCAAGGGAAATCGCGAACTACTGGAAGACGGGGAAGGCTCT
CTAGCAAACAAAACAGGTCGCCGCTCCGCTTCTGACTTTGCCCTGTGGAAAGCCTCGAAACCAGGTGAACCATCA
TGGCCATCATTTTGGGGACCTGGACGACCCGGTTGGCATATTGAATGTTCTGTGATGGCCAGTGCTATCTTTGGT
GATAATATGGATATCCACTCTGGTGGTATCGACTTGGCTTTCCCACATCACGACAACGAGATGGCTCAGTCCGAG
GCCTATCACAATTGTCGCGCCTGGGTTAATTACTTTTGGCATACAGGGCATTTACACATTGAGGGACTCAAGATG
AGCAAATCGTTGAAGAATTTCATCACTATCGATGAGATCCTCCGCAAATATACCGCCCGGCAACTGAGGCTAGCC
TTCTTAACCCAGCTGTGGAATGCGAAAGTAGATTTCTCGGAATCTTTGATGACGGGAGAAGTTCGTAATATTGAG
ATCACCATGAATAATTTCTTTACGGTCGTTAAAGCCCTGGTCAACCAACATCGCAGCGACGCTATCAGATCGGAC
GGGTTTCATCACTACGAGGCACTCGAACAAGACTTGACTAAAAGTTTTTACGAAGCTCAATCGGCCTTTAGAAGC
GCATTGTCGGACTCTTTTGATACGCCGGTAGCTTTGAATGCTCTCCGCGAACTGGTCTCAAAAACAAATATTTAC
ATCAATTCGCGCGGCAAGCATCTAAACGTTGCCCTTGTTGAAAATATTGCCCGGTGGGTTGGACAGATGCTTCGC
ATGTTTGGTTTAGGAGAAGGGGAGAAGGTGGAGCCTGGTTGGGGTCAAGCAGATCAAGGAGTTGGAAACATCAAC
CGAGAGGAGGTCTTGACGCCATATCTGCGAGCCTTGTCTTCTTTCCGTGATGGTGTTCGCCAACTGGCTATTGCC
AAAAATGATACTGCTCTTAAGGATATACTCGCGCTTTGCGACAAGCTCCGTGATGTTGACCTGGTTCCTCTTGGT
GTCGCTCTTGATGATCAAGATGATGGAAAGGCTCTAGTCAAACTTGTACCGCCAGCGGAGCTCATCAAAGCCCGA
GATGAGAAACGAGCGCAGCAAGATGCTAAAGCCTCAAAAAAAGCAGCTAGTATTGAGGAAGAGCGAAGAAAGCGG
ATTGCTAAGCTTGAGAAAGGTCGTACACCGCCGCAGGATATGTTTAGAAATTGTCCCGGGTATGGATCTTTAGAT
GATGAAGGCATACCGCGGACAGATGCCGAGGGTAAAGAGCTTAGTAAAAATCAAGCTAAGAAAGTTCAGAAGCAG
TGGCAGGAGCAAGAAAAGTTGCACAAAGCGTATTTGGAATGGCAGAAAACGTTATCCCCGTAG
Transcript >AgabiH97|041940
ATGACCACGCAGCCCCCTTGGTCGCTGCCAAAACAACAGCCGGAAGAACCTGTTCTTTATGTCTACAATTCGTTG
ACCAGAACTAAAACAAAATTTGTTCCGACCAACGAGCGTCACGTCAAATGGTACAACTGCGGTCCTACGGTTTAT
GACGCCTCACACTTGGGTCATGCAAGAAACTACGTCACACAGGATATTCTCCGCCGGGTAATGACTGATTATTTC
GGTTACGACGTGCATTTTGTTATGAATATCACGGATATCGATGATAAAATAATCTCTCGCGCTCGCCAAAATCAC
CTCATTGAGAACTTCCGATCTGAGAGTAACGCTCTTACTCCTGAACTAGTGGACACCGTCTTCGAAGCTTGGACG
ATCCATGTCAGAGACAAAGTAAATAAAGGATTACCAAGTGATCAGAAGGTAGTTGAGGGATCTGAAGAGGCAAGC
TGGCCAAAATTATCTGTTCTGATACAGAGCCCGGAATGGAAGCAAGAGTGCTTGAAACGCGACGAAAAGTTCGAT
ATGCACTTCACAGCAGCTAATCGCTGCTTATTGGCCATTCGAAACGCAAGAGACCAAATGCAATCTGGCGTTAAA
TCCGTGGATGAAGCTCATAATTTGATTGACGAGTCTAAGGATATTTTGGCTCGGACATTAGACGCAAAGTATAAA
TCTACGGTCACTGACCCTAACATATCTCGATCCCTTGCTTCCTATTGGGAAACCAAATTCTTCGAAGATATGGCC
CGCCTTAACGTTCGAGAGCCTGATACAGTTACTCGCGTCACAGAATTTATACCCGAAATTGTTGATTTCATAAAG
CGCATCATGGATAATGGTTTCGCATACGAATCGGAAGGCAGCGTGTATTTCAACACCATCAAGTTTGATAATGCG
GATGACCATGATTATGCGAAACTCGAGCCGTGGAGCAAGGGAAATCGCGAACTACTGGAAGACGGGGAAGGCTCT
CTAGCAAACAAAACAGGTCGCCGCTCCGCTTCTGACTTTGCCCTGTGGAAAGCCTCGAAACCAGGTGAACCATCA
TGGCCATCATTTTGGGGACCTGGACGACCCGGTTGGCATATTGAATGTTCTGTGATGGCCAGTGCTATCTTTGGT
GATAATATGGATATCCACTCTGGTGGTATCGACTTGGCTTTCCCACATCACGACAACGAGATGGCTCAGTCCGAG
GCCTATCACAATTGTCGCGCCTGGGTTAATTACTTTTGGCATACAGGGCATTTACACATTGAGGGACTCAAGATG
AGCAAATCGTTGAAGAATTTCATCACTATCGATGAGATCCTCCGCAAATATACCGCCCGGCAACTGAGGCTAGCC
TTCTTAACCCAGCTGTGGAATGCGAAAGTAGATTTCTCGGAATCTTTGATGACGGGAGAAGTTCGTAATATTGAG
ATCACCATGAATAATTTCTTTACGGTCGTTAAAGCCCTGGTCAACCAACATCGCAGCGACGCTATCAGATCGGAC
GGGTTTCATCACTACGAGGCACTCGAACAAGACTTGACTAAAAGTTTTTACGAAGCTCAATCGGCCTTTAGAAGC
GCATTGTCGGACTCTTTTGATACGCCGGTAGCTTTGAATGCTCTCCGCGAACTGGTCTCAAAAACAAATATTTAC
ATCAATTCGCGCGGCAAGCATCTAAACGTTGCCCTTGTTGAAAATATTGCCCGGTGGGTTGGACAGATGCTTCGC
ATGTTTGGTTTAGGAGAAGGGGAGAAGGTGGAGCCTGGTTGGGGTCAAGCAGATCAAGGAGTTGGAAACATCAAC
CGAGAGGAGGTCTTGACGCCATATCTGCGAGCCTTGTCTTCTTTCCGTGATGGTGTTCGCCAACTGGCTATTGCC
AAAAATGATACTGCTCTTAAGGATATACTCGCGCTTTGCGACAAGCTCCGTGATGTTGACCTGGTTCCTCTTGGT
GTCGCTCTTGATGATCAAGATGATGGAAAGGCTCTAGTCAAACTTGTACCGCCAGCGGAGCTCATCAAAGCCCGA
GATGAGAAACGAGCGCAGCAAGATGCTAAAGCCTCAAAAAAAGCAGCTAGTATTGAGGAAGAGCGAAGAAAGCGG
ATTGCTAAGCTTGAGAAAGGTCGTACACCGCCGCAGGATATGTTTAGAAATTGTCCCGGGTATGGATCTTTAGAT
GATGAAGGCATACCGCGGACAGATGCCGAGGGTAAAGAGCTTAGTAAAAATCAAGCTAAGAAAGTTCAGAAGCAG
TGGCAGGAGCAAGAAAAGTTGCACAAAGCGTATTTGGAATGGCAGAAAACGTTATCCCCGTAG
Gene >AgabiH97|041940
ATGACCACGCAGCCCCCTTGGTCGCTGCCAAAACAACAGCCGGAAGAACCTGTTCTTTATGTCTACAATTCGTTG
ACCAGAACTAAAGTTCGTATCGATGACTCGTATTATGTCCCATGTACAAAAGCTCACGACGAATTGTTCGTAGAC
AAAATTTGTTCCGACCAACGAGCGTCACGTCAAATGGTACAACTGCGGTCCTACGGTTTATGACGCCTCACACTT
GGGTCATGCAAGGTATTCCAGCCAGCTCATACTACGTGGCATCTTAAAATAATAATATCTTAGAAACTACGTCAC
ACAGGATATTCTCCGCCGGGTAATGACTGATTATTTCGGTTACGACGTGCATTTTGTTATGAATATCACGGATAT
CGATGATAAAGTTCGCCTATTTTTTGCGGTCACTCCCGGAATCCTTACCTACCCATGATCAGATAATCTCTCGCG
CTCGCCAAAATCACCTCATTGAGAACTTCCGATCTGAGAGTAACGCTCTTACTCCTGAACTAGTGGACACCGTCT
TCGAAGCTTGGACGATCCATGTCAGAGACAAAGTAAATAAAGGATTACCAAGTGATCAGAAGGTAGTTGAGGGAT
CTGAAGAGGCAAGCTGGCCAAAATTATCTGTTCTGATACAGAGCCCGGAATGGAAGCAAGAGTGCTTGAAACGCG
ACGAAAAGTTCGATATGCACTTCACAGCAGCTGTAAGCCACCACTATATATATCTAGTTTTTCTCAACAGCTTTT
ACCTCAGAATCGCTGCTTATTGGCCATTCGAAACGCAAGAGACCAAATGCAATCTGGCGTTAAATCCGTGGATGA
AGCTCATAATTTGATTGACGAGTCTAAGGATATTTTGGCTCGGACATTAGACGCAAAGGTTTTTGACTGTCTCCT
CACTCAGAAGTATTTATCGGCTTATATGGTATATTGACAGTATAAATCTACGGTCACTGACCCTAACATATCTCG
ATCCCTTGCTTCCTATTGGGAAACCAAATTCTTCGAAGATATGGCCCGCCTTAACGTTCGAGAGCCTGATACAGT
TACTCGCGTCACAGAATTTATACCCGAAATTGTTGATTTCATAAAGCGCATCATGGATAATGGTTTCGCATACGA
ATCGGAAGGCAGCGTGTATTTCAACACCATCAAGTTTGATAATGCGGATGACCATGATTATGCGAAACTCGAGCC
GTGGAGCAAGGGAAATCGCGAACTACTGGAAGACGGGGAAGGTCAGTTTGGAAGGCTAGCTCATGCGGAAAGCTA
ACGATCGGTTCTCAGGCTCTCTAGCAAACAAAACAGGTCGCCGCTCCGCTTCTGACTTTGCCCTGTGGAAAGCCT
CGAAACCAGGTGAACCATCATGGCCATCATTTTGGGGACCTGGACGACCCGGTTGGCATATTGAATGTTCTGTGA
TGGCCAGTGCTATCTTTGGTGATAATATGGATATCCACTCTGGTGGTATCGACTTGGCTTTCCCACATCACGACA
ACGAGATGGCTCAGTCCGAGGTGTGTGATGCCGACAAAAAAAGTAACATCAATATCTGATATAGTCCAGGCCTAT
CACAATTGTCGCGCCTGGGTTAATTACTTTTGGCATACAGGGCATTTACACATTGAGGGACTCAAGATGAGCAAA
TCGTTGAAGAATTTCATCACTATCGATGCGAGTTGTGCAGGCACTGGAGTACCGTGATGTGGCACTAATATTTAA
ATTCAGGAGATCCTCCGCAAATATACCGCCCGGCAACTGAGGCTAGCCTTCTTAACCCAGCTGTGGAATGCGAAA
GTAGATTTCTCGGAATCTTTGATGACGGGAGAAGTTCGTAATATTGAGATCACCATGAATGTGAGCCGAAGTGTT
CGTGCGTCGGAGGTCAAGTTGACAAATAGTACCACTTTCATAGAATTTCTTTACGGTCGTTAAAGCCCTGGTCAA
CCAACATCGCAGCGACGCTATCAGATCGGACGGGTTTCATCACTACGAGGCACTCGAACAAGACTTGACTAAAAG
GTTTCGTGACTTTTTTTGCCCTGCAATTTGCGAGCTGAAGATGTATCTAGTTTTTACGAAGCTCAATCGGCCTTT
AGAAGCGCATTGTCGGACTCTTTTGATACGCCGGTAGCTTTGAATGCTCTCCGCGAACTGGTCTCAAAAACAAAT
ATTTACATCAATTCGCGCGGCAAGCATCTAAACGTTGCCCTTGTTGAAAATATTGCCCGGTGGGTTGGACAGATG
CTTCGCATGTTTGGTTTAGGAGAAGGGGAGAAGGTGGAGCCTGGTTGGGGTCAAGCAGATCAAGGAGTTGGAAAC
ATCAACGTATGTTGTTGGTTCTATTCACTTGATCAAATTCTCAACTAAAATTCCATCTAGCGAGAGGAGGTCTTG
ACGCCATATCTGCGAGCCTTGTCTTCTTTCCGTGATGGTGTTCGCCAACTGGCTATTGCCAAAAATGATACTGCT
CTTAAGGATATACTCGCGCTTTGCGACAAGCTCCGTGATGTTGACCTGGTTCCTCTTGGTGTCGCTCTTGATGAT
CAAGATGGTGAGTTTTTCACGTTGCAAATGTCGATGCAGTAGGTTATTCATCACTTGTTCTCGACTCAGATGGAA
AGGCTCTAGTCAAACTTGTACCGCCAGCGGAGCTCATCAAAGCCCGAGATGAGAAACGAGCGCAGCAAGATGCTA
AAGCCTCAAAAAAAGCAGCTAGTATTGAGGAAGAGCGAAGAAAGCGGATTGCTAAGCTTGAGAAAGGTCGTACAC
CGCCGCAGGATATGTTTAGAAATTGTCCCGGGTATGGATCTTTAGATGATGAAGGCATACCGCGGACAGATGCCG
AGGGTAAAGAGCTTAGTAAAAATCAAGCTAAGAAAGTTCAGAAGCAGTGGCAGGAGCAAGAAAAGTTGCACAAAG
CGTATTTGGAATGGCAGAAAACGTTATCCCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail