Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041900
Gene name
Locationscaffold_2:859095..860304
Strand+
Gene length (bp)1209
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03153 TFIIA Transcription factor IIA, alpha/beta subunit 5.6E-21 9 185
PF03153 TFIIA Transcription factor IIA, alpha/beta subunit 1.0E-40 175 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USU9|TOA1_SCHPO Transcription initiation factor IIA large subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=toa1 PE=1 SV=1 1 305 3.0E-36
sp|Q5RCU0|TF2AA_PONAB Transcription initiation factor IIA subunit 1 OS=Pongo abelii GN=GTF2A1 PE=2 SV=1 234 305 3.0E-13
sp|P52655|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 OS=Homo sapiens GN=GTF2A1 PE=1 SV=1 234 305 3.0E-13
sp|O08949|TF2AA_RAT Transcription initiation factor IIA subunit 1 OS=Rattus norvegicus GN=Gtf2a1 PE=1 SV=1 234 305 4.0E-13
sp|Q99PM3|TF2AA_MOUSE Transcription initiation factor IIA subunit 1 OS=Mus musculus GN=Gtf2a1 PE=2 SV=2 234 305 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USU9|TOA1_SCHPO Transcription initiation factor IIA large subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=toa1 PE=1 SV=1 1 305 3.0E-36
sp|Q5RCU0|TF2AA_PONAB Transcription initiation factor IIA subunit 1 OS=Pongo abelii GN=GTF2A1 PE=2 SV=1 234 305 3.0E-13
sp|P52655|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 OS=Homo sapiens GN=GTF2A1 PE=1 SV=1 234 305 3.0E-13
sp|O08949|TF2AA_RAT Transcription initiation factor IIA subunit 1 OS=Rattus norvegicus GN=Gtf2a1 PE=1 SV=1 234 305 4.0E-13
sp|Q99PM3|TF2AA_MOUSE Transcription initiation factor IIA subunit 1 OS=Mus musculus GN=Gtf2a1 PE=2 SV=2 234 305 6.0E-13
sp|P52654|TF2AA_DROME Transcription initiation factor IIA subunit 1 OS=Drosophila melanogaster GN=TfIIA-L PE=1 SV=2 238 305 3.0E-12
sp|P32773|TOA1_YEAST Transcription initiation factor IIA large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOA1 PE=1 SV=1 234 305 5.0E-12
sp|Q8R4I4|TF2AY_MOUSE TFIIA-alpha and beta-like factor OS=Mus musculus GN=Gtf2a1l PE=1 SV=2 188 305 4.0E-11
sp|Q54G80|TF2AA_DICDI Transcription initiation factor IIA subunit 1 OS=Dictyostelium discoideum GN=gtf2a1 PE=3 SV=1 263 305 5.0E-11
sp|Q9UNN4|TF2AY_HUMAN TFIIA-alpha and beta-like factor OS=Homo sapiens GN=GTF2A1L PE=1 SV=2 260 305 8.0E-11
sp|Q9UNN4|TF2AY_HUMAN TFIIA-alpha and beta-like factor OS=Homo sapiens GN=GTF2A1L PE=1 SV=2 6 81 1.0E-07
sp|O08949|TF2AA_RAT Transcription initiation factor IIA subunit 1 OS=Rattus norvegicus GN=Gtf2a1 PE=1 SV=1 6 53 3.0E-06
sp|P52654|TF2AA_DROME Transcription initiation factor IIA subunit 1 OS=Drosophila melanogaster GN=TfIIA-L PE=1 SV=2 6 54 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0005672 transcription factor TFIIA complex Yes
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140513 nuclear protein-containing complex No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0009058 biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0005667 transcription regulator complex No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0032991 protein-containing complex No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041900
MSNKIVPSIYRTVIDDVIANIKSEFDEYGVSEEVLAELQSKWETKVIASHVAEFESPPQPQQPVAPPHPPAHPAY
PPHAMHMMQTHYAANPYAAMAPPPATGQTQVKSEPVDTRYMLASNYYAPSLSGPNMNRTLPPPVPTAPHPGARPY
VPPASAQPQANHQSSPPVNGHASSAAGGQSAPAAQQRIPQVDGPSESSGDEGSPEPTGYAPRTSHPSLPQPGSVQ
PSQAAVAKDEEAINSDLDDSDTENEAEAEEGGTGDTDIVFCTYDKVARVKNKWKCILKDGMIHVNGKDYLFAKCT
GEFEW*
Coding >AgabiH97|041900
ATGTCCAATAAGATAGTGCCTTCCATTTACCGAACCGTTATTGACGATGTCATCGCAAACATTAAATCCGAATTC
GATGAATACGGTGTCTCAGAGGAAGTCCTCGCCGAATTGCAGAGTAAATGGGAGACCAAAGTTATAGCGTCTCAT
GTAGCTGAATTCGAGTCTCCGCCGCAACCGCAGCAGCCTGTAGCGCCGCCTCATCCGCCAGCGCATCCTGCATAT
CCTCCACATGCAATGCATATGATGCAGACGCATTATGCGGCAAACCCCTACGCTGCTATGGCACCACCCCCTGCT
ACTGGACAAACCCAAGTGAAATCGGAACCAGTTGATACGCGCTACATGCTCGCATCAAACTATTATGCACCTTCG
TTATCCGGTCCCAATATGAATAGAACTCTTCCACCACCGGTGCCAACAGCACCGCATCCTGGAGCTCGTCCTTAT
GTACCTCCTGCTTCTGCGCAACCACAAGCGAATCATCAGTCATCACCGCCGGTGAATGGCCATGCTTCTTCTGCA
GCAGGAGGTCAGTCCGCGCCTGCTGCACAACAACGGATACCGCAGGTCGATGGTCCTTCGGAGTCATCTGGAGAC
GAAGGCTCTCCAGAGCCTACGGGATATGCACCTCGAACGTCTCATCCTTCATTGCCTCAACCAGGATCCGTCCAA
CCATCACAAGCTGCCGTAGCCAAGGATGAAGAGGCCATCAATAGTGATTTGGATGACTCGGATACCGAGAACGAG
GCTGAGGCTGAAGAAGGAGGCACGGGTGATACTGATATTGTGTTTTGCACTTACGACAAGGTTGCTCGAGTCAAG
AACAAATGGAAATGCATCCTCAAAGATGGAATGATCCACGTCAACGGCAAGGATTATCTATTTGCCAAATGCACT
GGTGAATTCGAATGGTAA
Transcript >AgabiH97|041900
ATGTCCAATAAGATAGTGCCTTCCATTTACCGAACCGTTATTGACGATGTCATCGCAAACATTAAATCCGAATTC
GATGAATACGGTGTCTCAGAGGAAGTCCTCGCCGAATTGCAGAGTAAATGGGAGACCAAAGTTATAGCGTCTCAT
GTAGCTGAATTCGAGTCTCCGCCGCAACCGCAGCAGCCTGTAGCGCCGCCTCATCCGCCAGCGCATCCTGCATAT
CCTCCACATGCAATGCATATGATGCAGACGCATTATGCGGCAAACCCCTACGCTGCTATGGCACCACCCCCTGCT
ACTGGACAAACCCAAGTGAAATCGGAACCAGTTGATACGCGCTACATGCTCGCATCAAACTATTATGCACCTTCG
TTATCCGGTCCCAATATGAATAGAACTCTTCCACCACCGGTGCCAACAGCACCGCATCCTGGAGCTCGTCCTTAT
GTACCTCCTGCTTCTGCGCAACCACAAGCGAATCATCAGTCATCACCGCCGGTGAATGGCCATGCTTCTTCTGCA
GCAGGAGGTCAGTCCGCGCCTGCTGCACAACAACGGATACCGCAGGTCGATGGTCCTTCGGAGTCATCTGGAGAC
GAAGGCTCTCCAGAGCCTACGGGATATGCACCTCGAACGTCTCATCCTTCATTGCCTCAACCAGGATCCGTCCAA
CCATCACAAGCTGCCGTAGCCAAGGATGAAGAGGCCATCAATAGTGATTTGGATGACTCGGATACCGAGAACGAG
GCTGAGGCTGAAGAAGGAGGCACGGGTGATACTGATATTGTGTTTTGCACTTACGACAAGGTTGCTCGAGTCAAG
AACAAATGGAAATGCATCCTCAAAGATGGAATGATCCACGTCAACGGCAAGGATTATCTATTTGCCAAATGCACT
GGTGAATTCGAATGGTAA
Gene >AgabiH97|041900
ATGTCCAATAAGATAGTGGTGAGCTGCTCACCAATCACTGGCTGCAGTAAGATGCTGGATTTTAACGACGATGTT
TCTTGGGATTATTGAGCCTTCCATTTACCGAACCGTTATTGACGATGTCATCGCAAACATTAAATCCGAATTCGA
TGAATACGGTGTCTCAGAGGAAGTCCTCGCCGAATTGCAGAGTGCAAGTCTGTTCGTTCTTACCCCTTACTCTAT
CTGATGTGCCGTGTAGAAATGGGAGACCAAAGTTATAGCGTCTCATGTAGCTGAATTCGAGTCTCCGCCGCAACC
GCAGCAGCCTGTAGCGCCGCCTCATCCGCCAGCGCATCCTGCATATCCTCCACATGCAATGCATATGATGCAGAC
GCATTATGCGGCAAACCCCTACGCTGCTATGGCACCACCCCCTGCTACTGGACAAACCCAAGTGAAATCGGAACC
AGTTGATACGCGCTACATGCTCGCATCAAACTATTATGCACCTTCGTTATCCGGTCCCAATATGAATAGAACTCT
TCCACCACCGGTGCCAACAGCACCGCATCCTGGAGGTCAGGCTGGTATTCTTTCATTTCCTGGACCTGGTCAGAC
ACCACTACCTGTATCTACAGCTCGTCCTTATGTACCTCCTGCTTCTGCGCAACCACAAGCGAATCATCAGTCATC
ACCGCCGGTGAATGGCCATGCTTCTTCTGCAGCAGGAGGTCAGTCCGCGCCTGCTGCACAACAACGGATACCGCA
GGTCGATGGTCCTTCGGAGTCATCTGGAGACGAAGGCTCTCCAGAGCCTACGGGATATGCACCTCGAACGTCTCA
TCCTTCATTGCCTCAACCAGGATCCGTCCAACCATCACAAGCTGCCGTAGCCAAGGATGAAGAGGCCATCAATAG
TGATTTGGATGACTCGGATACCGAGAACGAGGCTGAGGCTGAAGAAGGAGGCACGGGTGATACTGATATTGTGTT
TTGCACTTACGACAAGGTATTGATATCTTCCTCCCTTCTTTTGTTCAGTGGCTGACGCATATTACAGGTTGCTCG
AGTCAAGAACAAATGGAAATGCATCCTCAAAGATGGAATGATCCACGTCAACGGCAAGGATTATCTATTTGCCAA
ATGCACTGGGTCAGTTGTCTCGTGCTGTTCATATCCCTTTATTGCGATCTTAACTTTCCTCTCCTCAGTGAATTC
GAATGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail