Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041880
Gene name
Locationscaffold_2:855073..856732
Strand-
Gene length (bp)1659
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 1.1E-98 14 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 10 395 4.0E-51
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 31 395 2.0E-49
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 394 9.0E-47
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 394 1.0E-46
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 394 4.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 10 395 4.0E-51
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 31 395 2.0E-49
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 28 394 9.0E-47
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 28 394 1.0E-46
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 28 394 4.0E-46
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 28 394 1.0E-45
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 84 106 22
3 119 138 19
4 169 191 22
5 216 238 22
6 267 289 22
7 296 315 19
8 338 360 22
9 369 391 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041880
MPPSTSGLNAAALALVATRIVAALFSPENVLKRDQLLSTPLSSYTQLREGIFLFKHNIDPYSGGTFRHSPLLLAL
FSTILPNSRTFASLLWTAFDLLGAWALVSIWRARQNVSHTSRDILVAASYLLNPYVFLPTLALSSSSFQSSLTLL
SVKYAAEGNASLALFLLSILLHIDLSTFILLPPVLLLLITGPRSHLASPHALAANLLRIIPHFCRYLLYTGILAI
VSTSITGGTRWIPQTWGATLTLPDLTPNTGLWWYFFTEMFDHFRPFFLMVFTLHLSIYAIPMCIKFQYDPLYATF
LLLGVLGTFKAYPTLSDPGLFLSALSLFPEVYPYLRHQMVTALLHLHAALLMPLFNYLWLSTGTGNANFFYASTL
VFACANGAALIDAIWAGLRIAIGEEKEGYMVVQE*
Coding >AgabiH97|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCGACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACTCAGGGAGGGC
ATTTTCCTCTTCAAACACAACATAGACCCATATTCTGGTGGGACCTTTCGACATTCTCCCCTCCTTCTCGCGCTA
TTTTCTACCATACTCCCCAATTCGCGAACCTTCGCATCGCTCCTGTGGACAGCTTTTGACTTATTGGGTGCTTGG
GCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACACGTCAAGAGATATTTTGGTCGCCGCAAGTTAC
CTATTGAACCCCTACGTTTTTCTACCAACTTTGGCTCTTTCATCCTCCAGTTTCCAATCATCTTTGACTCTTCTC
TCAGTCAAGTATGCAGCCGAAGGAAACGCGTCTCTAGCGCTCTTCTTGCTATCAATACTTCTTCATATCGATCTC
TCAACATTTATCCTTCTTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACAC
GCCCTAGCTGCCAACCTTCTTCGTATCATTCCACACTTCTGCAGATACTTGTTATACACAGGTATTCTTGCCATT
GTATCAACAAGTATCACAGGCGGCACGCGATGGATACCACAAACTTGGGGAGCCACGCTTACTTTACCTGATTTG
ACTCCAAACACGGGTCTATGGTGGTATTTTTTCACGGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTC
TTCACTCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTACGATCCTTTATATGCTACCTTC
CTCCTTCTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTC
TCACTGTTCCCCGAAGTCTACCCTTATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTCCACGCAGCACTG
CTTATGCCCCTCTTCAATTACTTGTGGCTCAGTACCGGAACTGGCAATGCCAATTTCTTCTATGCCTCGACCTTG
GTTTTCGCTTGCGCAAATGGGGCCGCGCTTATTGATGCCATTTGGGCCGGCTTGCGCATTGCAATTGGTGAAGAG
AAGGAGGGTTATATGGTTGTACAAGAATGA
Transcript >AgabiH97|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCGACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACTCAGGGAGGGC
ATTTTCCTCTTCAAACACAACATAGACCCATATTCTGGTGGGACCTTTCGACATTCTCCCCTCCTTCTCGCGCTA
TTTTCTACCATACTCCCCAATTCGCGAACCTTCGCATCGCTCCTGTGGACAGCTTTTGACTTATTGGGTGCTTGG
GCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACACGTCAAGAGATATTTTGGTCGCCGCAAGTTAC
CTATTGAACCCCTACGTTTTTCTACCAACTTTGGCTCTTTCATCCTCCAGTTTCCAATCATCTTTGACTCTTCTC
TCAGTCAAGTATGCAGCCGAAGGAAACGCGTCTCTAGCGCTCTTCTTGCTATCAATACTTCTTCATATCGATCTC
TCAACATTTATCCTTCTTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACAC
GCCCTAGCTGCCAACCTTCTTCGTATCATTCCACACTTCTGCAGATACTTGTTATACACAGGTATTCTTGCCATT
GTATCAACAAGTATCACAGGCGGCACGCGATGGATACCACAAACTTGGGGAGCCACGCTTACTTTACCTGATTTG
ACTCCAAACACGGGTCTATGGTGGTATTTTTTCACGGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTC
TTCACTCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTACGATCCTTTATATGCTACCTTC
CTCCTTCTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTC
TCACTGTTCCCCGAAGTCTACCCTTATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTCCACGCAGCACTG
CTTATGCCCCTCTTCAATTACTTGTGGCTCAGTACCGGAACTGGCAATGCCAATTTCTTCTATGCCTCGACCTTG
GTTTTCGCTTGCGCAAATGGGGCCGCGCTTATTGATGCCATTTGGGCCGGCTTGCGCATTGCAATTGGTGAAGAG
AAGGAGGGTTATATGGTTGTACAAGAATGA
Gene >AgabiH97|041880
ATGCCTCCTTCGACGAGTGGACTCAATGCGGCAGCGCTGGCTCTCGTCGCGACCAGGATAGTCGCCGCTCTCTTC
TCTCCCGAAAATGTCCTCAAGCGCGACCAGTTGTTATCTACGCCACTGTCCTCTTATACCCAACGTTAGTGTCTT
CATTTGCATTACAGTGCTACTCAACATATTGTCTGTTCAGTCAGGGAGGGCATTTTCCTCTTCAAACACAACATA
GACCCATATTCTGGTGGGACCTTTCGACATGTACCCCGTTATCCTCACTTGTATCTGCAATCAGAGGGTTAACCT
GTCGTTCTAGTCTCCCCTCCTTCTCGCGCTATTTTCTACCATACTCCCCAATTCGCGAACCTTCGCATCGCTCCT
GTGGACAGCTTTTGACTTATTGGGTGCTTGGGCACTTGTGTCAATATGGAGGGCGCGACAAAATGTATCGCACAC
GTCAAGAGATATTTTGGTCGCCGCAAGGTGTGAATCGAACTATTCAAACGGCAATATCGTTTATAACCCAGTTCT
ACAGTTACCTATTGAACCCCTACGTTTTTCTACCAACTTTGGCTCTTTCATCCTCCAGTTTCCAATCATCTTTGA
CTCTTCTCTCAGTCAAGTATGCAGCCGAAGGTGGGTATCGCCAATACTACTCAGACTCATTCTTGACTCATTCTT
TATACAGGAAACGCGTCTCTAGCGCTCTTCTTGCTATCAATACTTCTTCATATCGATCTCTCAACATTTATCCTT
CTTCCCCCAGTTCTTCTTCTACTCATTACTGGCCCACGCTCTCATCTCGCATCTCCACACGCCCTAGCTGCCAAC
CTTCTTCGTATCATTCCACACTTCTGCAGATACTTGTTATACACAGGTATTCTTGCCATTGTATCAACAAGTATC
ACAGGCGGCACGCGATGGATACCACAAACTTGGGGAGCCACGTATGTTTTCCTGTTCTTTCGTTCATCGCCCTCA
CCTGAGTTTGATTATTGCCCAGGCTTACTTTACCTGATTTGACTCCAAACACGGGTCTATGGTGGTATTTTTTCA
CGGAAATGTTTGACCATTTTCGTCCGTTCTTCCTCATGGTCTTCACTGTGAGGCTCGACTTTTTTTATTTTACTA
TCATAATTGCTAACATTGATTCTAGCTTCATCTCTCGATCTATGCGATACCTATGTGCATCAAGTTTCAGTATGT
TTTCTTCCCCACTCTTCTCTTGTCTCGATTCACATGACTATCTACAGGTACGATCCTTTATATGCTACCTTCCTC
CTTCTCGGCGTACTAGGGACGTTCAAGGCGTACCCAACGTTGTCAGATCCTGGCCTATTCCTTAGTGCCCTCTCA
CTGTTCCCCGAAGTCTACCCTTGTGAGATTCCTATGCAACAAGCTTGTTCTGTTTCAGCTGATCAGATTGCACTT
CCAGATCTCAGACATCAAATGGTCACTGCACTTCTTCATCTCCACGCAGCACTGCTTATGCCCCTCTTCAATTAC
TTGTGGCTCAGTACCGGAACTGGCAATGCCAATTTCTTCTATGCCTCGACCTTGGTTTTCGCTTGCGCAAATGGG
GCCGCGCTTATTGATGCCATTTGGGCCGGCTTGCGCATTGCAATTGGTGAAGAGAAGGAGGGTTATATGGTTGTA
CAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail