Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041780
Gene name
Locationscaffold_2:832663..833467
Strand+
Gene length (bp)804
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 1.1E-10 114 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 82 201 5.0E-21
sp|Q8L8T2|GRXC1_ARATH Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2 104 206 2.0E-18
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 104 201 2.0E-17
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 103 202 3.0E-17
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 103 201 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6K953|GRXC4_ORYSJ Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1 82 201 5.0E-21
sp|Q8L8T2|GRXC1_ARATH Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2 104 206 2.0E-18
sp|P55143|GLRX_RICCO Glutaredoxin OS=Ricinus communis PE=3 SV=1 104 201 2.0E-17
sp|Q9ZR41|GLRX_SOLLC Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1 103 202 3.0E-17
sp|P55142|GRXC6_ORYSJ Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2 103 201 5.0E-17
sp|Q9FNE2|GRXC2_ARATH Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1 104 201 1.0E-16
sp|P38068|GLRX7_YEAST Monothiol glutaredoxin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX7 PE=1 SV=1 94 199 2.0E-16
sp|B7ZFT1|GLRX1_RHIID Glutaredoxin-1 OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GRX1 PE=2 SV=3 104 197 3.0E-15
sp|Q0J3L4|GRS10_ORYSJ Monothiol glutaredoxin-S10 OS=Oryza sativa subsp. japonica GN=GRXS10 PE=2 SV=2 113 206 4.0E-15
sp|Q9UTI2|GLRX2_SCHPO Glutaredoxin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx2 PE=3 SV=1 106 199 1.0E-14
sp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S6 OS=Oryza sativa subsp. japonica GN=GRXS6 PE=2 SV=1 114 200 1.0E-14
sp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana GN=GRXC4 PE=2 SV=2 87 210 3.0E-14
sp|O81187|GLRX_VERFO Glutaredoxin OS=Vernicia fordii PE=3 SV=1 104 202 8.0E-14
sp|Q9Y7N3|GLRX3_SCHPO Monothiol glutaredoxin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx3 PE=3 SV=3 107 199 2.0E-13
sp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C8 OS=Oryza sativa subsp. japonica GN=GRXC8 PE=2 SV=2 112 197 2.0E-13
sp|Q8LBS4|GRS12_ARATH Monothiol glutaredoxin-S12, chloroplastic OS=Arabidopsis thaliana GN=GRXS12 PE=1 SV=2 110 200 6.0E-13
sp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C3 OS=Arabidopsis thaliana GN=GRXC3 PE=2 SV=1 114 197 6.0E-12
sp|Q19297|YZ73_CAEEL Uncharacterized monothiol glutaredoxin F10D7.3 OS=Caenorhabditis elegans GN=F10D7.3 PE=3 SV=2 112 207 1.0E-11
sp|Q54GP8|GLRX_DICDI Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1 104 201 5.0E-11
sp|Q12438|GLRX6_YEAST Monothiol glutaredoxin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX6 PE=1 SV=1 113 208 3.0E-10
sp|Q9LIF1|GRS10_ARATH Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1 107 201 3.0E-10
sp|P17695|GLRX2_YEAST Glutaredoxin-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX2 PE=1 SV=3 100 198 4.0E-10
sp|Q8GWS0|GRXC5_ARATH Glutaredoxin-C5, chloroplastic OS=Arabidopsis thaliana GN=GRXC5 PE=1 SV=1 114 200 9.0E-10
sp|Q32L67|GLRX2_BOVIN Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1 95 208 1.0E-09
sp|Q8L8Z8|GRXS2_ARATH Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1 113 201 2.0E-09
sp|P12309|GLRX1_PIG Glutaredoxin-1 OS=Sus scrofa GN=GLRX PE=1 SV=2 108 201 3.0E-09
sp|O36032|GLRX1_SCHPO Glutaredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx1 PE=3 SV=1 114 200 6.0E-09
sp|Q9NS18|GLRX2_HUMAN Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1 106 200 2.0E-08
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 114 199 2.0E-08
sp|O23421|GRXS3_ARATH Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1 106 201 3.0E-08
sp|Q6AXW1|GLRX2_RAT Glutaredoxin-2, mitochondrial OS=Rattus norvegicus GN=Glrx2 PE=2 SV=2 95 200 4.0E-08
sp|Q923X4|GLRX2_MOUSE Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1 106 208 4.0E-08
sp|Q5RC53|GLRX2_PONAB Glutaredoxin-2, mitochondrial OS=Pongo abelii GN=GLRX2 PE=2 SV=1 106 200 6.0E-08
sp|P12864|GLRX1_RABIT Glutaredoxin-1 OS=Oryctolagus cuniculus GN=GLRX PE=1 SV=1 106 201 7.0E-08
sp|Q6NLU2|GRXS7_ARATH Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2 104 201 8.0E-08
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 114 199 9.0E-08
sp|O23419|GRXS4_ARATH Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1 104 201 1.0E-07
sp|Q9ESH6|GLRX1_RAT Glutaredoxin-1 OS=Rattus norvegicus GN=Glrx PE=3 SV=3 106 201 1.0E-07
sp|O23420|GRXS5_ARATH Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1 106 201 1.0E-07
sp|P10575|GLRX1_BOVIN Glutaredoxin-1 OS=Bos taurus GN=GLRX PE=1 SV=3 108 201 2.0E-07
sp|Q9SA68|GRXS1_ARATH Monothiol glutaredoxin-S1 OS=Arabidopsis thaliana GN=GRXS1 PE=3 SV=1 113 201 2.0E-07
sp|O23417|GRXS8_ARATH Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana GN=GRXS8 PE=3 SV=1 104 201 3.0E-07
sp|P35754|GLRX1_HUMAN Glutaredoxin-1 OS=Homo sapiens GN=GLRX PE=1 SV=2 106 201 9.0E-07
sp|Q9QUH0|GLRX1_MOUSE Glutaredoxin-1 OS=Mus musculus GN=Glrx PE=1 SV=3 106 201 9.0E-07
sp|Q9LYC5|GRC14_ARATH Glutaredoxin-C14 OS=Arabidopsis thaliana GN=GRXC14 PE=3 SV=1 104 198 1.0E-06
sp|P25373|GLRX1_YEAST Glutaredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX1 PE=1 SV=1 114 185 4.0E-06
sp|O82255|GRC13_ARATH Glutaredoxin-C13 OS=Arabidopsis thaliana GN=GRXC13 PE=3 SV=1 104 198 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0015035 protein-disulfide reductase activity No
GO:0015036 disulfide oxidoreductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041780
MSTRRTLIRLLLLVFVVSAFIWTFGSHLPESWKDTGILAYPLSRANILRAQKQTNELYGLLYLVTTDSEENQHIL
ADRVDLDPSEPIALEVYAAGNKALDWTAKTEEINSKYPVIVFSKTFCPFSKKAKELLTRYDLQPPPKIIEVDIRA
DSSTLKVLLTRLTHHSTFPNVIIRGKSIGGSDDLQALHKNHTLSDLLKEAGVSVQNKEVQ*
Coding >AgabiH97|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCCAACATTCTACGAGCT
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACCGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGATCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCCCTTGAT
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGACTTTTTGCCCATTTTCA
AAGAAAGCCAAAGAACTGTTGACCAGGTATGATCTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGCC
GACTCGAGCACGCTCAAGGTCCTTCTCACCCGCCTTACCCATCATTCCACCTTCCCCAACGTCATTATCCGTGGC
AAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATACTCTCTCTGATTTGCTGAAGGAAGCC
GGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA
Transcript >AgabiH97|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCCAACATTCTACGAGCT
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACCGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGATCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCCCTTGAT
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGACTTTTTGCCCATTTTCA
AAGAAAGCCAAAGAACTGTTGACCAGGTATGATCTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGCC
GACTCGAGCACGCTCAAGGTCCTTCTCACCCGCCTTACCCATCATTCCACCTTCCCCAACGTCATTATCCGTGGC
AAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATACTCTCTCTGATTTGCTGAAGGAAGCC
GGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA
Gene >AgabiH97|041780
ATGTCCACCCGTCGCACGCTAATTCGCCTCTTACTTCTAGTCTTCGTCGTCTCAGCGTTCATCTGGACCTTTGGC
TCGCACCTGCCGGAGTCCTGGAAAGACACAGGCATCTTAGCATATCCGTTATCACGTGCCAACATTCTACGAGCT
CAGAAGCAAACAAATGAGCTCTATGGCTTGCTCTATCTTGTCACCACCGACTCGGAAGAGAATCAACATATTTTG
GCCGATAGAGTGGATCTGGATCCATCCGAGCCAATTGCCCTGGAGGTCTACGCTGCTGGAAACAAGGCCCTTGAT
TGGACTGCTAAGACAGAAGAAATAAATTCAAAGTATCCCGTCATCGTGTTCAGCAAGGTACGTCTTTGGTTCAAC
ATAGAACGAGTTCCGTCTTTTGTTCTGACACACTTGAATAGACTTTTTGCCCGTGTGTACACCTCGCTACAATTT
TGCCATGCTTGACGCTGAATTCTTCGCTTCCCTAGATTTTCAAAGAAAGCCAAAGAACTGTTGACCAGGTATGAT
CTGCAGCCGCCCCCTAAAATTATCGAGGTAGACATCAGAGGTAACCCTTTTTCATGCCTGAATAATACGCATTTT
TGACTTGAAGTGTGACCAGCCGACTCGAGCACGCTCAAGGTCCTTCTCACCCGCCTTACCCATCATTCCACCTTC
CCCAACGTCATTATCCGTGGCAAGTCCATTGGGGGTTCAGACGACTTGCAAGCGTTACATAAAAACCATACTCTC
TCTGATTTGCTGAAGGAAGCCGGGGTGTCGGTTCAGAATAAAGAGGTTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail