Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041740
Gene name
Locationscaffold_2:823137..824916
Strand-
Gene length (bp)1779
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.7E-29 67 269
PF13649 Methyltransf_25 Methyltransferase domain 4.8E-14 126 219
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-12 121 223
PF08241 Methyltransf_11 Methyltransferase domain 5.0E-12 127 219
PF08242 Methyltransf_12 Methyltransferase domain 3.0E-08 127 219
PF05175 MTS Methyltransferase small domain 2.0E-08 124 197
PF13489 Methyltransf_23 Methyltransferase domain 2.4E-07 120 219
PF03848 TehB Tellurite resistance protein TehB 4.2E-06 125 206
PF02390 Methyltransf_4 Putative methyltransferase 6.8E-06 125 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 17 302 3.0E-56
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 12 280 2.0E-49
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 12 287 2.0E-47
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 12 306 9.0E-47
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 12 306 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 17 302 3.0E-56
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 12 280 2.0E-49
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 12 287 2.0E-47
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 12 306 9.0E-47
sp|C3SBU5|TNMT1_PAPBR (S)-tetrahydroprotoberberine N-methyltransferase 1 OS=Papaver bracteatum PE=1 SV=1 12 306 1.0E-45
sp|C3SBU4|TNMT2_PAPBR Probable (S)-tetrahydroprotoberberine N-methyltransferase 2 OS=Papaver bracteatum PE=2 SV=1 12 287 3.0E-45
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 12 287 4.0E-42
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 71 266 3.0E-19
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 71 266 3.0E-19
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 67 206 7.0E-15
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 66 211 5.0E-14
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 66 211 5.0E-14
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 66 211 5.0E-14
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 67 220 7.0E-14
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 73 261 1.0E-13
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 66 265 6.0E-13
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 61 214 2.0E-11
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 61 236 6.0E-11
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 85 204 8.0E-11
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 57 203 1.0E-10
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 57 203 1.0E-10
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 57 203 1.0E-10
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 74 274 2.0E-10
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 66 233 3.0E-10
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 66 233 3.0E-10
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 66 273 6.0E-10
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 66 273 6.0E-10
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 66 273 6.0E-10
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 71 206 8.0E-10
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 71 206 8.0E-10
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 71 206 9.0E-10
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 53 213 1.0E-09
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 53 213 1.0E-09
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 53 213 2.0E-09
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 70 266 9.0E-07
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 70 266 9.0E-07
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 70 266 9.0E-07
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 70 266 9.0E-07
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 124 219 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0008033 tRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0034470 ncRNA processing No
GO:0016740 transferase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0008173 RNA methyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0008175 tRNA methyltransferase activity No
GO:0034660 ncRNA metabolic process No
GO:0009451 RNA modification No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041740
MDFILQNGYNLLDRGLVPDFVLRRVIRLLCHGRLREIDLGSFEANHAAKMQWIEDVKARAVIADVPAKANEQHYE
VSTKFMLSTLGPHAKYSSCLYPTGDETLAEAEECMLESYCWKAQLRDGIEILDLGCGWGSLSLFLAKKYPNSNIT
GLSNSATQKSYIDSTAKERGLTNIKIITADVNTFDFENPKKFDRILSVEMFEHMKNYQALFQKISTWLRSTKETT
EIDDPALLFVHIFCHKSTPYHFVEDDGWMAKNFFSGGTMPSHDLFTYFQDDLTLMKNIAKKGCRSLNRTPLRRVA
RLKRAEKPSTGSVTRMGSRTLSL*
Coding >AgabiH97|041740
ATGGATTTCATTCTACAAAACGGGTACAACTTATTGGATAGGGGACTGGTACCGGATTTTGTTCTACGGCGTGTC
ATTCGACTTCTTTGCCATGGGCGCCTCCGCGAGATTGATCTTGGTTCCTTTGAGGCCAACCATGCTGCTAAAATG
CAATGGATCGAAGATGTGAAAGCCCGTGCGGTAATTGCAGACGTACCCGCCAAAGCCAACGAACAACATTACGAG
GTTTCAACCAAGTTTATGCTGTCGACTTTGGGTCCTCATGCCAAATACTCATCATGTCTCTACCCGACTGGAGAT
GAAACCCTGGCAGAAGCAGAAGAATGTATGCTCGAAAGTTACTGCTGGAAAGCTCAGCTAAGAGATGGGATAGAA
ATCCTCGACCTTGGATGTGGATGGGGGAGTCTTTCTCTTTTCTTAGCCAAGAAATATCCCAATTCGAATATCACT
GGTCTTTCAAACTCGGCGACGCAGAAATCATATATCGATTCGACGGCTAAAGAACGGGGATTGACGAATATAAAG
ATTATCACCGCAGATGTCAATACGTTTGATTTTGAAAATCCCAAAAAGTTCGACCGCATTTTGTCTGTTGAGATG
TTTGAACATATGAAGAACTATCAAGCACTTTTCCAGAAAATATCTACCTGGCTCCGGTCGACTAAAGAGACTACA
GAAATAGACGACCCTGCACTCTTATTTGTTCATATCTTCTGCCACAAATCTACACCTTACCATTTCGTCGAGGAT
GACGGTTGGATGGCCAAGAACTTTTTCTCAGGCGGAACAATGCCTTCACACGATCTTTTCACTTATTTCCAAGAT
GATCTGACGTTAATGAAGAACATAGCAAAGAAGGGTTGCAGGAGCTTGAACAGGACGCCGTTGCGAAGGGTAGCT
CGGCTGAAGAGGGCAGAAAAGCCTTCTACAGGTTCCGTGACAAGAATGGGGAGTCGGACATTATCTCTTTAA
Transcript >AgabiH97|041740
ATGGATTTCATTCTACAAAACGGGTACAACTTATTGGATAGGGGACTGGTACCGGATTTTGTTCTACGGCGTGTC
ATTCGACTTCTTTGCCATGGGCGCCTCCGCGAGATTGATCTTGGTTCCTTTGAGGCCAACCATGCTGCTAAAATG
CAATGGATCGAAGATGTGAAAGCCCGTGCGGTAATTGCAGACGTACCCGCCAAAGCCAACGAACAACATTACGAG
GTTTCAACCAAGTTTATGCTGTCGACTTTGGGTCCTCATGCCAAATACTCATCATGTCTCTACCCGACTGGAGAT
GAAACCCTGGCAGAAGCAGAAGAATGTATGCTCGAAAGTTACTGCTGGAAAGCTCAGCTAAGAGATGGGATAGAA
ATCCTCGACCTTGGATGTGGATGGGGGAGTCTTTCTCTTTTCTTAGCCAAGAAATATCCCAATTCGAATATCACT
GGTCTTTCAAACTCGGCGACGCAGAAATCATATATCGATTCGACGGCTAAAGAACGGGGATTGACGAATATAAAG
ATTATCACCGCAGATGTCAATACGTTTGATTTTGAAAATCCCAAAAAGTTCGACCGCATTTTGTCTGTTGAGATG
TTTGAACATATGAAGAACTATCAAGCACTTTTCCAGAAAATATCTACCTGGCTCCGGTCGACTAAAGAGACTACA
GAAATAGACGACCCTGCACTCTTATTTGTTCATATCTTCTGCCACAAATCTACACCTTACCATTTCGTCGAGGAT
GACGGTTGGATGGCCAAGAACTTTTTCTCAGGCGGAACAATGCCTTCACACGATCTTTTCACTTATTTCCAAGAT
GATCTGACGTTAATGAAGAACATAGCAAAGAAGGGTTGCAGGAGCTTGAACAGGACGCCGTTGCGAAGGGTAGCT
CGGCTGAAGAGGGCAGAAAAGCCTTCTACAGGTTCCGTGACAAGAATGGGGAGTCGGACATTATCTCTTTAA
Gene >AgabiH97|041740
ATGGATTTCATTCTACAAAACGGGTACAACTTATTGGATAGGGTCTGTCATGACACAAGTCCGTATACCTCGTCT
GACACGATGCAACGCAGGGACTGGTACCGGATTTTGTTCTACGGCGTGTCATTCGACTTCTTTGCCATGGGCGCC
TCCGCGAGATTGATCTTGGTTCCTTTGAGGCCAACCATGCTGCTAAAATGCAATGGATCGAAGATGTGAAAGCCC
GTGCGGTAATTGCAGACGTACCCGCCAAAGCCAACGAACAACATTACGAGGTGTGTCCAGGTCAACGTCTAACAA
CCGTTCGTGCCTGGTTAAACAAATCTAGGTTTCAACCAAGTTTATGCTGTCGACTTTGGGTCCTCATGCCAAATA
CTCATCATGTCTCTACCCGACTGGAGATGAAACCCTGGCAGAAGCAGAAGAATGTATGCTCGAAAGTTACTGCTG
GAAAGCTCAGCTAAGAGATGGGATAGAAATCCTCGACCTTGGATGTGGTATGACTACGTTTATTTCTCAAACTCA
GGGTTGTGATGGTAACGAGGATTACAATAAAAGGATGGGGGAGTCTTTCTCTTTTCTTAGCCAAGGTTCGTAGTG
CGGAACATCATCGGCATTAGAGTTGCGCACGCTTACTTTGGCTTTTCATCAGAAATATCCCAATTCGAATATCAC
TGGTCTTTCAAACTCGGCGACGCAGAAATCATATATCGATTCGACGGCTAAAGAACGGGGATTGACGAATATAAA
GGTATCGGAACCAATATCTATCGTTAGCCATGACTAACAACCTAATAGATTATCACCGCAGATGTCAATACGTTT
GATTTTGAAAATCCCAAAAAGTAAGCGACGCCGCCTAAAATTGACTCAACCACACTCTGAAGTAATTCAAAGGTT
CGACCGCATTTTGTCTGTTGAGGTAAGTAGACTTTCACGTATTCTATATCCATCTGTCAACATGACTCCACTGTT
GGGCATCATGACGCAGATGTTTGAACATATGAAGAACTATCAAGCACTTTTCCAGAAAATATCTACCTGGCTCCG
GTCGACTAAAGAGACTACAGAAATAGACGACCCTGCACTCTTATTTGTTCATATCTTCTGCCACAAATCTACACC
TTACCATTTCGTCGAGGATGACGGTTGGATGGCCAAGAACTTTTTCTCAGGTGACTTCCATCATTATTCAACTGT
TTCATCTGAAGTGAAGGATTCAAATCTTTCGTCAATTACATACTACTCACTTAGGCGGAACAATGCCTTCACACG
ATCTTTTCGTGAGTACCATTGATTGTAACTCCCCCCTTAACAACACGAAGTATTGATCAAACGTCCGTTGTTTAG
ACTTATTTCCAAGATGATCTGACGTTAATGAAGAGTTGGTTTATTTCTGGCACCAACTATTCCAGAACATGCGAA
GATTGGCTGAAGACTCAAGATAGACATAGCAAAGGTGTCCAACAACCCCTCAATCATCTCAATTCCCACTAACGT
TTGCCTGCCCGAAATAAAGAAGGGTTGCAGGAGCTTGAACAGGACGCCGTTGCGAAGGGTAGCTCGGCTGAAGAG
GGCAGAAAAGCCTTCTACAGGTTAGCCTTTTTCGTTCCAATGTCGAGCTAAATGACAACGTAATGGCAGGTTCCG
TGTATTTTATATGGCTTGTTCAGAGCTGTTTAACCTGAACGGAGGACAAGAGTATGTGGTCATATGTTTAGCCAA
CGTAACTGATTCTTACAATCTGGCCAGATGGGGAGTCGGACATTATCTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail