Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041640
Gene name
Locationscaffold_2:797433..799833
Strand+
Gene length (bp)2400
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.6E-10 88 130
PF04433 SWIRM SWIRM domain 1.1E-09 499 566

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 25 214 9.0E-51
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 24 214 4.0E-47
sp|Q75LL6|TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2 25 562 1.0E-44
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 20 568 3.0E-44
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 300 565 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 25 214 9.0E-51
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 24 214 4.0E-47
sp|Q75LL6|TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2 25 562 1.0E-44
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 20 568 3.0E-44
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 300 565 2.0E-43
sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana GN=ADA2A PE=1 SV=1 20 565 6.0E-42
sp|Q02336|ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 300 566 9.0E-42
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 21 214 4.0E-40
sp|Q9P7J7|ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ada2 PE=1 SV=1 315 566 3.0E-30
sp|Q3SZP8|TAD2A_BOVIN Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2A PE=2 SV=1 320 566 5.0E-26
sp|O75478|TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens GN=TADA2A PE=1 SV=3 320 566 2.0E-25
sp|Q5ZJF3|TAD2A_CHICK Transcriptional adapter 2-alpha OS=Gallus gallus GN=TADA2A PE=2 SV=1 320 566 3.0E-24
sp|Q6AYE3|TAD2A_RAT Transcriptional adapter 2-alpha OS=Rattus norvegicus GN=Tada2a PE=2 SV=1 320 566 3.0E-23
sp|Q8CHV6|TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus GN=Tada2a PE=1 SV=1 320 566 4.0E-23
sp|Q503N9|TAD2B_DANRE Transcriptional adapter 2-beta OS=Danio rerio GN=tada2b PE=2 SV=1 22 134 1.0E-16
sp|Q6AYE3|TAD2A_RAT Transcriptional adapter 2-alpha OS=Rattus norvegicus GN=Tada2a PE=2 SV=1 19 241 2.0E-16
sp|O75478|TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens GN=TADA2A PE=1 SV=3 19 241 4.0E-16
sp|Q8CHV6|TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus GN=Tada2a PE=1 SV=1 19 241 5.0E-16
sp|Q3SZP8|TAD2A_BOVIN Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2A PE=2 SV=1 19 241 3.0E-15
sp|Q6NRB5|TAD2B_XENLA Transcriptional adapter 2-beta OS=Xenopus laevis GN=tada2b PE=2 SV=1 27 212 4.0E-14
sp|Q5ZJF3|TAD2A_CHICK Transcriptional adapter 2-alpha OS=Gallus gallus GN=TADA2A PE=2 SV=1 19 137 1.0E-13
sp|Q86TJ2|TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2 18 212 1.0E-13
sp|Q5RBN9|TAD2B_PONAB Transcriptional adapter 2-beta OS=Pongo abelii GN=TADA2B PE=2 SV=1 18 212 1.0E-13
sp|Q8I8V0|TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster GN=Ada2b PE=1 SV=1 15 214 3.0E-13
sp|Q7KSD8|TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster GN=Rpb4 PE=1 SV=1 312 566 2.0E-11
sp|Q5RBN9|TAD2B_PONAB Transcriptional adapter 2-beta OS=Pongo abelii GN=TADA2B PE=2 SV=1 352 566 1.0E-08
sp|Q86TJ2|TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2 352 566 1.0E-08
sp|Q6NRB5|TAD2B_XENLA Transcriptional adapter 2-beta OS=Xenopus laevis GN=tada2b PE=2 SV=1 318 566 2.0E-08
sp|Q7KSD8|TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster GN=Rpb4 PE=1 SV=1 27 134 3.0E-08
sp|O13719|LAF1_SCHPO SWIRM domain-containing protein laf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=laf1 PE=1 SV=1 488 566 5.0E-07
sp|O74443|LAF2_SCHPO SWIRM domain-containing protein laf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=laf2 PE=1 SV=1 488 566 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041640
MTVTQRKSQHIPDEVQTVNEPGEQYECDACACDLTHTVRIKCADPVCTNDEGVDICPACFCAGKEFKDHKRWHSY
RVIELNSYPIFTEDWGADEELHLITGLAQHGMGNWKRISEHLGTRTKEDIEKHYESVYIDSPDWPLPRVDQHLSV
DPDEFQERKRRRIAEMSSVTAPTQKVAPTSAPGVHEVASFLPGRLEFEHENDNDAEDRVKDLEFGICLEWGGDQI
IEDEFDPDVQARLKIAEERNNGFLISGASITLPAGKGPPAPQTNGSINGHHVNGDVKRDVKSEDAAMANGSNGEE
EEVEEPTRPPPYETKDSLKFKLTLLEEYGQRVEKRHQDKALMFERGLLEYKKIQAADKKKGKEEREILHRLRPFA
RLQTAEDYESFSADILYEAILRKRIQELQHYRRLGLSTAADIDKYENDLSKRTQVKAQARDYDRSQYRSSGRQSS
GPDPRRSSLVSYCESDDRSREPTPRLPGTAPPVRRPPPPLNLANSPSLHLLTPAEQTLCSQLRILPKPYLVVKET
LVREYARRGGKLRRREARDLVKIDVNKTSRIWDFLVQAGFLKITTDTASHSAPAAASGPQDASLQSSATNGSPSK
SPRPPLPPAIASVSSASSSVNGSLYSSSQHVSQATWPPNPT*
Coding >AgabiH97|041640
ATGACGGTCACCCAGCGAAAGTCACAACACATCCCAGACGAAGTCCAAACTGTCAATGAACCCGGAGAGCAGTAC
GAGTGCGATGCGTGCGCATGTGACCTTACACACACTGTTCGAATCAAATGTGCCGATCCCGTATGCACCAATGAC
GAAGGCGTCGATATTTGCCCAGCATGCTTTTGTGCTGGGAAGGAGTTCAAGGACCACAAGAGGTGGCATTCCTAT
CGCGTCATTGAGTTGAATTCCTACCCCATCTTTACCGAAGACTGGGGTGCAGATGAGGAACTTCACTTAATTACT
GGGCTAGCTCAACATGGTATGGGCAATTGGAAAAGAATTTCTGAACATTTGGGTACGAGGACCAAGGAGGATATA
GAAAAACATTATGAGAGTGTCTACATCGACTCACCGGATTGGCCACTACCGCGAGTGGACCAGCATCTCTCTGTG
GACCCTGACGAATTTCAGGAGCGTAAACGACGTCGAATAGCAGAAATGAGCTCTGTTACCGCCCCAACACAAAAA
GTAGCACCAACTTCTGCTCCAGGTGTACATGAAGTCGCTTCTTTCCTGCCGGGTCGTCTAGAATTTGAGCACGAG
AATGATAACGATGCAGAAGATCGTGTCAAAGATTTGGAATTTGGAATCTGTTTGGAATGGGGAGGAGATCAGATT
ATTGAAGATGAGTTCGATCCTGATGTTCAGGCCCGTCTGAAGATAGCGGAAGAGCGCAATAATGGCTTCCTGATA
TCCGGTGCTTCAATAACACTGCCGGCAGGAAAGGGCCCACCTGCACCTCAAACCAATGGCTCTATCAATGGTCAC
CACGTCAATGGTGATGTCAAAAGAGACGTAAAATCAGAAGATGCGGCGATGGCTAATGGTAGCAATGGAGAGGAA
GAGGAGGTGGAAGAGCCAACACGACCTCCCCCTTATGAAACCAAGGATTCTCTGAAATTCAAATTGACACTTCTA
GAAGAATACGGCCAGCGAGTAGAGAAGCGGCATCAGGACAAAGCTCTCATGTTCGAACGTGGACTTTTGGAATAC
AAAAAGATACAAGCGGCCGACAAGAAAAAGGGAAAGGAAGAGCGCGAGATTCTGCATCGACTACGACCATTTGCG
AGGCTACAGACAGCTGAAGATTACGAATCATTTTCCGCGGATATCCTCTACGAGGCAATTTTACGAAAGCGTATT
CAAGAGCTTCAACACTACCGTCGTCTTGGGTTATCCACCGCTGCCGACATTGATAAATACGAAAATGACCTTTCT
AAGCGAACCCAGGTCAAGGCCCAAGCCCGTGATTACGACAGGTCACAGTATCGCAGTAGTGGAAGGCAATCCTCC
GGACCTGATCCTCGACGTTCTAGTCTTGTGTCCTACTGTGAATCAGACGACCGCTCTAGAGAGCCGACGCCACGT
TTACCAGGAACAGCTCCACCTGTCCGCCGCCCTCCACCTCCACTCAACCTCGCCAACAGTCCTTCATTGCATCTA
CTTACTCCCGCTGAACAAACCCTGTGCTCTCAACTTCGAATTCTTCCCAAGCCTTATCTTGTCGTCAAGGAAACA
CTTGTACGAGAGTACGCTCGAAGAGGAGGCAAACTTCGTCGGCGTGAAGCACGCGACCTGGTCAAGATTGATGTC
AATAAAACTAGTCGAATATGGGATTTTCTGGTGCAAGCAGGGTTCTTAAAGATTACCACCGATACTGCTAGCCAT
AGTGCGCCTGCAGCTGCCAGTGGTCCTCAAGATGCCAGTCTCCAATCCTCCGCTACCAACGGTTCTCCCTCAAAA
TCCCCTCGCCCGCCCCTGCCACCCGCCATTGCATCGGTCTCTTCAGCATCAAGCAGCGTGAACGGGTCATTGTAC
AGTTCATCGCAGCACGTATCACAAGCAACTTGGCCTCCAAATCCAACCTAA
Transcript >AgabiH97|041640
ATGACGGTCACCCAGCGAAAGTCACAACACATCCCAGACGAAGTCCAAACTGTCAATGAACCCGGAGAGCAGTAC
GAGTGCGATGCGTGCGCATGTGACCTTACACACACTGTTCGAATCAAATGTGCCGATCCCGTATGCACCAATGAC
GAAGGCGTCGATATTTGCCCAGCATGCTTTTGTGCTGGGAAGGAGTTCAAGGACCACAAGAGGTGGCATTCCTAT
CGCGTCATTGAGTTGAATTCCTACCCCATCTTTACCGAAGACTGGGGTGCAGATGAGGAACTTCACTTAATTACT
GGGCTAGCTCAACATGGTATGGGCAATTGGAAAAGAATTTCTGAACATTTGGGTACGAGGACCAAGGAGGATATA
GAAAAACATTATGAGAGTGTCTACATCGACTCACCGGATTGGCCACTACCGCGAGTGGACCAGCATCTCTCTGTG
GACCCTGACGAATTTCAGGAGCGTAAACGACGTCGAATAGCAGAAATGAGCTCTGTTACCGCCCCAACACAAAAA
GTAGCACCAACTTCTGCTCCAGGTGTACATGAAGTCGCTTCTTTCCTGCCGGGTCGTCTAGAATTTGAGCACGAG
AATGATAACGATGCAGAAGATCGTGTCAAAGATTTGGAATTTGGAATCTGTTTGGAATGGGGAGGAGATCAGATT
ATTGAAGATGAGTTCGATCCTGATGTTCAGGCCCGTCTGAAGATAGCGGAAGAGCGCAATAATGGCTTCCTGATA
TCCGGTGCTTCAATAACACTGCCGGCAGGAAAGGGCCCACCTGCACCTCAAACCAATGGCTCTATCAATGGTCAC
CACGTCAATGGTGATGTCAAAAGAGACGTAAAATCAGAAGATGCGGCGATGGCTAATGGTAGCAATGGAGAGGAA
GAGGAGGTGGAAGAGCCAACACGACCTCCCCCTTATGAAACCAAGGATTCTCTGAAATTCAAATTGACACTTCTA
GAAGAATACGGCCAGCGAGTAGAGAAGCGGCATCAGGACAAAGCTCTCATGTTCGAACGTGGACTTTTGGAATAC
AAAAAGATACAAGCGGCCGACAAGAAAAAGGGAAAGGAAGAGCGCGAGATTCTGCATCGACTACGACCATTTGCG
AGGCTACAGACAGCTGAAGATTACGAATCATTTTCCGCGGATATCCTCTACGAGGCAATTTTACGAAAGCGTATT
CAAGAGCTTCAACACTACCGTCGTCTTGGGTTATCCACCGCTGCCGACATTGATAAATACGAAAATGACCTTTCT
AAGCGAACCCAGGTCAAGGCCCAAGCCCGTGATTACGACAGGTCACAGTATCGCAGTAGTGGAAGGCAATCCTCC
GGACCTGATCCTCGACGTTCTAGTCTTGTGTCCTACTGTGAATCAGACGACCGCTCTAGAGAGCCGACGCCACGT
TTACCAGGAACAGCTCCACCTGTCCGCCGCCCTCCACCTCCACTCAACCTCGCCAACAGTCCTTCATTGCATCTA
CTTACTCCCGCTGAACAAACCCTGTGCTCTCAACTTCGAATTCTTCCCAAGCCTTATCTTGTCGTCAAGGAAACA
CTTGTACGAGAGTACGCTCGAAGAGGAGGCAAACTTCGTCGGCGTGAAGCACGCGACCTGGTCAAGATTGATGTC
AATAAAACTAGTCGAATATGGGATTTTCTGGTGCAAGCAGGGTTCTTAAAGATTACCACCGATACTGCTAGCCAT
AGTGCGCCTGCAGCTGCCAGTGGTCCTCAAGATGCCAGTCTCCAATCCTCCGCTACCAACGGTTCTCCCTCAAAA
TCCCCTCGCCCGCCCCTGCCACCCGCCATTGCATCGGTCTCTTCAGCATCAAGCAGCGTGAACGGGTCATTGTAC
AGTTCATCGCAGCACGTATCACAAGCAACTTGGCCTCCAAATCCAACCTAA
Gene >AgabiH97|041640
ATGACGGTCACCCAGCGAAAGTCACAACACATCCCAGACGAAGTCCAAAGTGATTTCTACGCCTTTCCTCTGTTG
TCCATGTCTACTAACCACGTCGCATGTTCCGCGTAGCTGTCAATGAACCCGGAGAGCAGTACGAGTGCGATGCGT
GCGCATGTGACCTTACACACACTGTTCGAATCAAATGTGCCGATCCCGTATGCACCAATGACGAAGGCGTCGATA
TTTGCCCAGCATGCTTTTGTGCTGGGAAGGAGTTCAAGGACCACAAGAGGTGGCATTCCTATCGCGTCATTGTGA
GTACGTCTAATTCAGGGAGGGCGATATATTTACCTTGGTACAGGAGTTGAATTCCTACCCCATCTTTACCGAAGA
CTGGGGTGCAGATGAGTGAGTCTCATCATCACGTTGCATGATGCAAAGCAATGACTCCGCATATAGGGAACTTCA
CTTAATTACTGGGCTAGCTCAACATGGTATGGGCAATTGGAAAAGAATTTCTGAACATTTGGGTACGAGGACCAA
GGAGGATATAGAAAAACATTATGAGAGTGTCTACATCGACTCACCGGATTGGCCACTACCGGTAAACATTTTTTA
CTTGCCCACATATATACGATAAAACTCATAGTTCTTTAGCGAGTGGACCAGCATCTCTCTGTGGACCCTGACGAA
TTTCAGGAGCGTAAACGACGTCGAATAGCAGAAATGAGCTCTGTTACCGCCCCAACACAAAAAGTAGCACCAACT
TCTGCTCCAGGTGTACATGAAGTCGCTTCTTTCCTGCCGGGTCGTCTAGAATTTGAGCACGAGAATGATAACGAT
GCAGAAGATCGTGTCAAAGATTTGGAATTTGGAATCTGTTTGGAATGGGGAGGAGATCAGATTATTGAAGATGAG
TTCGATCCTGATGTTCAGGCCCGTCTGAAGATAGCGGAAGAGCGCAATAATGGCTTCCTGATATCCGGTGCTTCA
ATAACACTGCCGGCAGGAAAGGGCCCACCTGCACCTCAAACCAATGGCTCTATCAATGGTCACCACGTCAATGGT
GATGTCAAAAGAGACGTAAAATCAGAAGATGCGGCGATGGCTAATGGTAGCAATGGAGAGGAAGAGGAGGTGGAA
GAGCCAACACGACCTCCCCCTTATGAAACCAAGGATTCTCTGAAATTCAAATTGACACTTCTAGAAGAATACGGC
CAGCGAGTAGAGAAGCGGCATCAGGACAAAGCTCTCATGTTCGAACGTGGACTTTTGGAATACAAAAAGGTGCCC
ATATCTCGTGATCATGTCCACTTCCGCCTCTGACGCGTTTCAGATACAAGCGGCCGACAAGAAAAAGGGAAAGGA
AGAGCGCGAGATTCTGCATCGACTACGACCATTTGCGAGGCTACAGACAGCTGAAGATTACGAATCATTTTCCGC
GGATATCCTCTGTGTGTATCTTCACACAACCATCTGCTGGAATATTCTGATATACTAGTCTATAGACGAGGCAAT
TTTACGAAAGCGTATTCAAGAGCTTCAACACTACCGTCGTCTTGGGTTATCCACCGCTGCCGACATTGATAAATA
CGAAAATGACCTTTCTAAGCGAGTGCGTATTTTGGCCGCTTTTTTCTCGCTCTATCTTGATCTCTGTGCCTCAGA
CCCAGGTCAAGGCCCAAGCCCGTGATTACGACAGGTCACAGTATCGCAGTAGTGGAAGGCAATCCTCCGGACCTG
ATCCTCGACGTTCTAGTCTTGTGTCCTACTGTGAATCAGACGACCGCTCTAGAGAGCCGACGCCACGTTTACCAG
GAACAGCTCCACCTGTCCGCCGCCCTCGTAAGTTAATGAATCGAGTAGTTTTCGTATATGCTCACTTTAGCGGCA
GCACCTCCACTCAACCTCGCCAACAGTCCTTCATTGCATCTACTTACTCCCGCTGAACAAACCCTGTGCTCTCAA
CTTCGAATTCTTCCCAAGCCTTATCTTGTCGTCAAGGAAACACTTGTACGAGAGTACGCTCGAAGAGGAGGCAAA
CTTCGTCGGCGTGAAGCACGCGACCTGGTCAAGATTGATGTCAATAAAACTAGTCGAATATGGGATTTTCTGGTG
CAAGCAGGGTTCTTAAAGATTACCACCGATACTGCTAGCCATAGTGCGCCTGCAGCTGCCAGTGGTCCTCAAGAT
GCCAGGTTTGTCTCGACTTACGCCATGTCCCCTCGCATTGCTCATCCGCTTATATTTCTCAGTCTCCAATCCTCC
GCTACCAACGGTTCTCCCTCAAAATCCCCTCGCCCGCCCCTGCCACCCGCCATTGCATCGGTCTCTTCAGCATCA
AGCAGCGTGAACGGGTCATTGTACAGTTCATCGCAGCACGTATCACAAGCAACTTGGCCTCCAAATCCAACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail