Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041460
Gene name
Locationscaffold_2:757769..761912
Strand+
Gene length (bp)4143
Transcript length (bp)3153
Coding sequence length (bp)3153
Protein length (aa) 1051

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 9.8E-73 394 557
PF03142 Chitin_synth_2 Chitin synthase 3.1E-18 535 710
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.6E-22 325 393
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.6E-06 537 762

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 224 1048 0.0E+00
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 293 1050 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 246 998 0.0E+00
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 313 1046 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 319 1043 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 224 1048 0.0E+00
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 293 1050 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 246 998 0.0E+00
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 313 1046 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 319 1043 0.0E+00
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 315 1048 0.0E+00
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 306 1047 0.0E+00
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 324 1044 0.0E+00
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 277 1048 0.0E+00
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 319 1050 0.0E+00
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 243 1049 0.0E+00
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 347 1049 0.0E+00
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 287 1050 0.0E+00
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 310 1050 0.0E+00
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 290 1050 0.0E+00
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 256 1050 0.0E+00
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 311 1050 0.0E+00
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 309 1050 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 308 1050 0.0E+00
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 315 1050 0.0E+00
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 309 1048 0.0E+00
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 289 1049 0.0E+00
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 306 1050 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 319 1043 2.0E-180
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 302 1043 2.0E-177
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 311 1043 1.0E-175
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 326 1049 4.0E-111
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 354 905 4.0E-100
sp|P30582|CHS2_ASPNG Chitin synthase 2 (Fragment) OS=Aspergillus niger GN=chs2 PE=3 SV=1 399 588 1.0E-84
sp|P30586|CHS2_EXOJE Chitin synthase 2 (Fragment) OS=Exophiala jeanselmei GN=CHS2 PE=3 SV=2 399 587 3.0E-82
sp|P30591|CHS2_EXOEX Chitin synthase 2 (Fragment) OS=Exophiala exophialae GN=CHS2 PE=3 SV=2 399 588 2.0E-81
sp|P30596|CHS1_SCHCO Chitin synthase 1 (Fragment) OS=Schizophyllum commune GN=CHS1 PE=3 SV=1 399 588 2.0E-80
sp|P30578|CHS3_AJECA Chitin synthase 3 (Fragment) OS=Ajellomyces capsulatus GN=CHS3 PE=3 SV=1 399 588 2.0E-80
sp|P30580|CHS2_AJEDE Chitin synthase 2 (Fragment) OS=Ajellomyces dermatitidis GN=CHS2 PE=3 SV=1 399 588 1.0E-79
sp|P55003|CHS1_TUBUN Chitin synthase 1 (Fragment) OS=Tuber uncinatum GN=CHS1 PE=3 SV=1 399 588 2.0E-79
sp|P30604|CHS2_XYLBA Chitin synthase 2 (Fragment) OS=Xylohypha bantiana GN=CHS2 PE=3 SV=1 399 588 2.0E-73
sp|P49603|CHS1_BOTFU Chitin synthase 1 (Fragment) OS=Botryotinia fuckeliana GN=chs1 PE=3 SV=1 399 587 3.0E-67
sp|P30576|CHS1_AJECA Chitin synthase 1 (Fragment) OS=Ajellomyces capsulatus GN=CHS1 PE=3 SV=1 399 588 2.0E-64
sp|P30579|CHS1_AJEDE Chitin synthase 1 (Fragment) OS=Ajellomyces dermatitidis GN=CHS1 PE=3 SV=1 401 588 2.0E-64
sp|P30581|CHS1_ASPNG Chitin synthase 1 (Fragment) OS=Aspergillus niger GN=chs1 PE=3 SV=1 399 588 1.0E-63
sp|P30585|CHS1_EXOJE Chitin synthase 1 (Fragment) OS=Exophiala jeanselmei GN=CHS1 PE=3 SV=1 399 587 2.0E-63
sp|P30590|CHS1_EXOEX Chitin synthase 1 (Fragment) OS=Exophiala exophialae GN=CHS1 PE=3 SV=1 399 587 7.0E-63
sp|P30592|CHS1_RHIAT Chitin synthase 1 (Fragment) OS=Rhinocladiella atrovirens GN=CHS1 PE=3 SV=1 399 587 1.0E-62
sp|P30603|CHS1_XYLBA Chitin synthase 1 (Fragment) OS=Xylohypha bantiana GN=CHS1 PE=3 SV=1 399 587 5.0E-61
sp|P30577|CHS2_AJECA Chitin synthase 2 (Fragment) OS=Ajellomyces capsulatus GN=CHS2 PE=3 SV=1 399 587 3.0E-53
sp|P30593|CHS2_RHIAT Chitin synthase 2 (Fragment) OS=Rhinocladiella atrovirens GN=CHS2 PE=3 SV=1 399 588 2.0E-49
sp|P30587|CHS3_EXOJE Chitin synthase 3 (Fragment) OS=Exophiala jeanselmei GN=CHS3 PE=3 SV=1 411 588 1.0E-45
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 537 903 1.0E-14
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 535 903 1.0E-12
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 539 903 1.0E-12
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 535 913 3.0E-11
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 535 903 3.0E-11
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 535 903 5.0E-11
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 535 903 7.0E-11
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 537 903 9.0E-11
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 535 903 2.0E-10
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 535 708 1.0E-09
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 563 903 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004100 chitin synthase activity Yes
GO:0006031 chitin biosynthetic process Yes
GO:0046349 amino sugar biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006022 aminoglycan metabolic process No
GO:0009058 biosynthetic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006040 amino sugar metabolic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0006030 chitin metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 704 722 18
2 743 765 22
3 780 802 22
4 815 837 22
5 847 866 19
6 983 1005 22
7 1020 1042 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041460
MARRKAVPRVASPKSESSSILSVDASVKRYTLTDPPMSQPLDQNMPLLSSNHDDTMNHPQISATMRTAATAEYNH
EDTYEQRQHEEAVIREYKPYTPGQYLEPIITGETLDLNEFMSEDEVPTPTSQQPSRLRYEHIPEQQPPPPPPPPQ
PQYLQPTPPSSDYHSSDFYSHSNSSSGHTYVPYNNTSEVMLVGSDIDHFQHDAEAAAYTSGTVYSTTTTSTSPYR
HSRRSRSPTPAVDDEDYYIVGSESIHYTGVHDDPEKGLFQDQYPDYFPTGHETTTTTTILYDPQPPTPTSQQTSL
PETPLDTQHFGPAPSGRAIRRHKTKKRVVLTNGNLVVNLEVPPRLVLPRRGMGEMMKTRYMAVTCDPDEFERNGF
FLRQNESGRRTELLIMITMYNEDEVLFCRTLYGVMRNISHLCTRKNSQTWGPNAWEKVVVCIIADGRKKIHPRVL
DCLTLLGVYQAGGHMKNMVNEKQVTAHVFEYTTSFALDPNLHFKFPDKGIVPTQIIFCMKEKNQKKINSHRWGFN
AFGAMLQPNVCVLLDVGTRPGSNSIYRLWKAFDLNSNVGGACGEISVYKGKNWSALLNPLVAAQNFEYKISCILD
KPTESLFGYISVLPGAFSAYRYIALQNNERGQGPLASYFKGEVLHGRDTDIFTSNMYLAEDRILCFELVAKANTN
WVLKYVKGAIGETDVPDSLPEFISQRRRWLNGSFFAATYAIAHVGQIMRSGHSLTRKVVLMVETVYNIINLIFAW
FSIGNFYLFFVVLTSSLEDPSFNLKGIKYFNTFMQYLMGSMIVASFIFSMGNRPAASKAKYKTTSIVLAILMLYM
IIGSVACAIEAARQGGAANSIMLLSVLVTYGLYALSSLLAFDPWHMITSFIPYIFLSPTYINVLNVYAFSNLDDI
SWGTKEDNTPDTDLGAVTQDINYQVDVELFSDTADVNSVYEEALTNLRDRKPVPGADRKHRMKTDAEKEQAAKDY
YASVRTNLLLAWVLSNGLLLLAILGGVSATNTFDRDAGVNRTKGYLIFILSFTAITNSVRFGGSTLYLMARLITG
*
Coding >AgabiH97|041460
ATGGCGCGAAGAAAGGCCGTCCCGCGTGTCGCCAGCCCCAAGAGCGAGTCCTCGTCGATTTTGTCTGTTGATGCC
AGCGTCAAGCGATATACTTTGACCGACCCTCCCATGTCTCAGCCACTAGACCAGAACATGCCACTCCTCTCTTCT
AATCACGACGACACCATGAACCACCCACAGATCTCGGCTACCATGCGTACTGCTGCTACTGCAGAGTATAACCAC
GAAGATACTTACGAACAACGACAACACGAAGAGGCGGTGATACGAGAGTATAAACCGTACACACCTGGGCAATAC
CTCGAGCCTATTATTACGGGAGAGACGCTGGACTTGAACGAATTCATGTCGGAAGACGAGGTACCTACGCCTACT
TCTCAACAACCCTCACGACTGCGATACGAGCATATCCCTGAACAGCAACCACCACCACCACCACCACCACCACAA
CCACAATATTTACAACCTACACCTCCCTCTTCCGATTATCACAGTTCAGATTTCTATTCACATTCGAATTCATCT
TCTGGACATACTTATGTTCCTTATAACAACACCTCTGAAGTTATGCTCGTAGGATCCGATATTGATCATTTTCAA
CATGATGCCGAGGCTGCGGCTTATACTAGTGGAACGGTTTATTCGACAACAACAACGTCGACGTCACCTTATCGA
CATTCAAGACGTTCTAGGTCTCCGACACCTGCTGTTGATGATGAAGATTATTATATTGTTGGAAGTGAAAGTATA
CATTATACTGGTGTACATGATGATCCCGAAAAAGGTTTGTTCCAAGATCAATATCCAGATTACTTTCCTACCGGA
CACGAAACCACAACAACAACAACAATCCTATACGATCCTCAACCACCCACACCTACATCCCAACAAACCTCTTTA
CCCGAAACACCTTTAGATACTCAACATTTTGGTCCGGCACCTTCGGGAAGAGCTATAAGACGACATAAGACGAAG
AAGAGGGTGGTTTTGACGAATGGGAATTTGGTGGTGAATTTGGAGGTACCGCCGAGGTTGGTTTTGCCGAGGAGG
GGGATGGGGGAGATGATGAAGACGAGGTATATGGCTGTGACTTGTGATCCGGATGAGTTTGAGAGGAATGGGTTT
TTTTTGAGACAGAATGAGAGTGGGAGGAGGACGGAGTTGTTGATTATGATTACGATGTATAATGAAGATGAAGTT
TTGTTTTGTCGGACGTTGTATGGTGTGATGCGAAATATTTCGCATTTATGTACACGTAAGAATTCACAAACCTGG
GGTCCAAACGCTTGGGAAAAGGTCGTAGTATGCATCATAGCCGACGGCCGTAAAAAAATTCATCCACGAGTCCTC
GATTGTCTAACTCTCCTCGGGGTCTATCAAGCTGGTGGACACATGAAAAACATGGTGAATGAAAAACAAGTGACG
GCACATGTATTTGAATATACGACTTCGTTTGCGTTGGATCCGAATTTACATTTCAAGTTTCCGGATAAGGGGATT
GTGCCGACGCAGATTATATTTTGTATGAAGGAGAAGAATCAGAAGAAGATTAATAGTCATAGATGGGGGTTTAAT
GCTTTTGGAGCTATGCTTCAGCCGAATGTGTGTGTGTTGTTGGATGTGGGGACGAGGCCGGGGAGTAATAGTATT
TATAGGTTGTGGAAGGCTTTTGATTTGAATTCGAATGTGGGAGGGGCTTGTGGAGAGATTTCGGTGTATAAAGGC
AAGAATTGGTCGGCGCTTTTGAATCCGTTGGTCGCGGCGCAGAATTTTGAGTACAAGATTAGTTGTATTCTGGAT
AAACCGACGGAAAGTCTGTTTGGATATATCAGTGTATTGCCAGGAGCATTTTCAGCGTATAGGTATATCGCGTTA
CAAAATAATGAGCGGGGACAAGGTCCGCTTGCGTCGTATTTTAAAGGCGAGGTTTTACATGGAAGAGATACCGAT
ATTTTTACTTCTAATATGTATCTTGCTGAAGATCGTATTCTTTGTTTTGAGCTGGTAGCCAAAGCCAACACAAAC
TGGGTCCTGAAATATGTTAAAGGTGCAATTGGAGAAACGGATGTTCCGGATTCGTTACCCGAGTTTATTTCTCAG
AGACGGAGGTGGTTGAATGGGTCTTTTTTTGCTGCTACTTATGCTATTGCGCATGTTGGACAGATTATGCGGTCG
GGACATAGTTTGACGAGGAAAGTTGTGTTGATGGTGGAGACGGTGTATAATATCATTAATTTGATTTTTGCGTGG
TTCAGTATTGGAAACTTTTATCTCTTTTTTGTTGTTTTGACGTCTTCACTTGAGGATCCGTCTTTCAACCTGAAA
GGGATTAAATACTTCAATACGTTTATGCAATATCTCATGGGTTCGATGATAGTAGCAAGTTTTATATTTTCTATG
GGGAACCGCCCTGCTGCGTCTAAAGCAAAATATAAAACGACCAGTATCGTTTTAGCTATATTGATGCTGTATATG
ATTATCGGATCTGTGGCATGCGCTATAGAAGCCGCTCGACAGGGAGGAGCTGCGAATTCGATTATGTTGTTGAGT
GTATTGGTTACTTATGGCCTATATGCTTTGAGCAGTTTATTGGCTTTTGATCCTTGGCATATGATCACCAGTTTT
ATTCCTTATATATTCCTTTCACCGACTTATATTAATGTTTTGAATGTCTATGCGTTCTCCAATCTGGATGATATT
TCTTGGGGTACAAAGGAGGACAACACTCCTGATACTGACCTTGGCGCTGTGACGCAAGATATCAATTATCAAGTA
GATGTAGAGCTCTTTTCAGATACCGCAGATGTCAACTCGGTTTATGAAGAAGCATTGACTAACCTTCGGGATCGA
AAACCTGTACCGGGAGCTGATAGAAAACATCGAATGAAGACGGATGCGGAAAAGGAACAAGCTGCTAAAGATTAT
TATGCGAGTGTTCGTACGAATTTGTTGTTGGCTTGGGTGTTATCGAATGGGTTATTGTTGTTGGCTATTCTTGGT
GGTGTTTCTGCGACGAATACGTTTGATCGTGATGCTGGGGTGAATAGGACGAAAGGGTATTTGATATTTATCCTT
TCGTTTACTGCGATTACGAATTCGGTGCGTTTTGGTGGTTCGACATTGTACCTTATGGCTCGATTGATTACTGGA
TGA
Transcript >AgabiH97|041460
ATGGCGCGAAGAAAGGCCGTCCCGCGTGTCGCCAGCCCCAAGAGCGAGTCCTCGTCGATTTTGTCTGTTGATGCC
AGCGTCAAGCGATATACTTTGACCGACCCTCCCATGTCTCAGCCACTAGACCAGAACATGCCACTCCTCTCTTCT
AATCACGACGACACCATGAACCACCCACAGATCTCGGCTACCATGCGTACTGCTGCTACTGCAGAGTATAACCAC
GAAGATACTTACGAACAACGACAACACGAAGAGGCGGTGATACGAGAGTATAAACCGTACACACCTGGGCAATAC
CTCGAGCCTATTATTACGGGAGAGACGCTGGACTTGAACGAATTCATGTCGGAAGACGAGGTACCTACGCCTACT
TCTCAACAACCCTCACGACTGCGATACGAGCATATCCCTGAACAGCAACCACCACCACCACCACCACCACCACAA
CCACAATATTTACAACCTACACCTCCCTCTTCCGATTATCACAGTTCAGATTTCTATTCACATTCGAATTCATCT
TCTGGACATACTTATGTTCCTTATAACAACACCTCTGAAGTTATGCTCGTAGGATCCGATATTGATCATTTTCAA
CATGATGCCGAGGCTGCGGCTTATACTAGTGGAACGGTTTATTCGACAACAACAACGTCGACGTCACCTTATCGA
CATTCAAGACGTTCTAGGTCTCCGACACCTGCTGTTGATGATGAAGATTATTATATTGTTGGAAGTGAAAGTATA
CATTATACTGGTGTACATGATGATCCCGAAAAAGGTTTGTTCCAAGATCAATATCCAGATTACTTTCCTACCGGA
CACGAAACCACAACAACAACAACAATCCTATACGATCCTCAACCACCCACACCTACATCCCAACAAACCTCTTTA
CCCGAAACACCTTTAGATACTCAACATTTTGGTCCGGCACCTTCGGGAAGAGCTATAAGACGACATAAGACGAAG
AAGAGGGTGGTTTTGACGAATGGGAATTTGGTGGTGAATTTGGAGGTACCGCCGAGGTTGGTTTTGCCGAGGAGG
GGGATGGGGGAGATGATGAAGACGAGGTATATGGCTGTGACTTGTGATCCGGATGAGTTTGAGAGGAATGGGTTT
TTTTTGAGACAGAATGAGAGTGGGAGGAGGACGGAGTTGTTGATTATGATTACGATGTATAATGAAGATGAAGTT
TTGTTTTGTCGGACGTTGTATGGTGTGATGCGAAATATTTCGCATTTATGTACACGTAAGAATTCACAAACCTGG
GGTCCAAACGCTTGGGAAAAGGTCGTAGTATGCATCATAGCCGACGGCCGTAAAAAAATTCATCCACGAGTCCTC
GATTGTCTAACTCTCCTCGGGGTCTATCAAGCTGGTGGACACATGAAAAACATGGTGAATGAAAAACAAGTGACG
GCACATGTATTTGAATATACGACTTCGTTTGCGTTGGATCCGAATTTACATTTCAAGTTTCCGGATAAGGGGATT
GTGCCGACGCAGATTATATTTTGTATGAAGGAGAAGAATCAGAAGAAGATTAATAGTCATAGATGGGGGTTTAAT
GCTTTTGGAGCTATGCTTCAGCCGAATGTGTGTGTGTTGTTGGATGTGGGGACGAGGCCGGGGAGTAATAGTATT
TATAGGTTGTGGAAGGCTTTTGATTTGAATTCGAATGTGGGAGGGGCTTGTGGAGAGATTTCGGTGTATAAAGGC
AAGAATTGGTCGGCGCTTTTGAATCCGTTGGTCGCGGCGCAGAATTTTGAGTACAAGATTAGTTGTATTCTGGAT
AAACCGACGGAAAGTCTGTTTGGATATATCAGTGTATTGCCAGGAGCATTTTCAGCGTATAGGTATATCGCGTTA
CAAAATAATGAGCGGGGACAAGGTCCGCTTGCGTCGTATTTTAAAGGCGAGGTTTTACATGGAAGAGATACCGAT
ATTTTTACTTCTAATATGTATCTTGCTGAAGATCGTATTCTTTGTTTTGAGCTGGTAGCCAAAGCCAACACAAAC
TGGGTCCTGAAATATGTTAAAGGTGCAATTGGAGAAACGGATGTTCCGGATTCGTTACCCGAGTTTATTTCTCAG
AGACGGAGGTGGTTGAATGGGTCTTTTTTTGCTGCTACTTATGCTATTGCGCATGTTGGACAGATTATGCGGTCG
GGACATAGTTTGACGAGGAAAGTTGTGTTGATGGTGGAGACGGTGTATAATATCATTAATTTGATTTTTGCGTGG
TTCAGTATTGGAAACTTTTATCTCTTTTTTGTTGTTTTGACGTCTTCACTTGAGGATCCGTCTTTCAACCTGAAA
GGGATTAAATACTTCAATACGTTTATGCAATATCTCATGGGTTCGATGATAGTAGCAAGTTTTATATTTTCTATG
GGGAACCGCCCTGCTGCGTCTAAAGCAAAATATAAAACGACCAGTATCGTTTTAGCTATATTGATGCTGTATATG
ATTATCGGATCTGTGGCATGCGCTATAGAAGCCGCTCGACAGGGAGGAGCTGCGAATTCGATTATGTTGTTGAGT
GTATTGGTTACTTATGGCCTATATGCTTTGAGCAGTTTATTGGCTTTTGATCCTTGGCATATGATCACCAGTTTT
ATTCCTTATATATTCCTTTCACCGACTTATATTAATGTTTTGAATGTCTATGCGTTCTCCAATCTGGATGATATT
TCTTGGGGTACAAAGGAGGACAACACTCCTGATACTGACCTTGGCGCTGTGACGCAAGATATCAATTATCAAGTA
GATGTAGAGCTCTTTTCAGATACCGCAGATGTCAACTCGGTTTATGAAGAAGCATTGACTAACCTTCGGGATCGA
AAACCTGTACCGGGAGCTGATAGAAAACATCGAATGAAGACGGATGCGGAAAAGGAACAAGCTGCTAAAGATTAT
TATGCGAGTGTTCGTACGAATTTGTTGTTGGCTTGGGTGTTATCGAATGGGTTATTGTTGTTGGCTATTCTTGGT
GGTGTTTCTGCGACGAATACGTTTGATCGTGATGCTGGGGTGAATAGGACGAAAGGGTATTTGATATTTATCCTT
TCGTTTACTGCGATTACGAATTCGGTGCGTTTTGGTGGTTCGACATTGTACCTTATGGCTCGATTGATTACTGGA
TGA
Gene >AgabiH97|041460
ATGGCGCGAAGAAAGGCCGTCCCGCGTGTCGCCAGCCCCAAGAGCGAGTCCTCGTCGATTTTGTCTGTTGATGCC
AGCGTCAAGCGATATACTTTGACCGACCCTCCCATGTCTCAGCCACTAGACCAGAACATGCCACTCCTCTCTTCT
AATCACGACGACACCATGAACCACCCACAGATCTCGGCTACCATGCGTACTGCTGCTACTGCAGAGTATAACCAC
GAAGATACTTACGAACAACGACAACACGAAGAGGCGGTGATACGAGAGTATAAACCGTACACACCTGGGCAATAC
CTCGAGCCTATTATTACGGGAGAGACGCTGGACTTGAACGAATTCATGTCGGAAGACGAGGTACCTACGCCTACT
TCTCAACAACCCTCACGACTGCGATACGAGCATATCCCTGAACAGCAACCACCACCACCACCACCACCACCACAA
CCACAATATTTACAACCTACACCTCCCTCTTCCGATTATCACAGTTCAGATTTCTATTCACATTCGAATTCATCT
TCTGGACATACTTATGTTCCTTATAACAACACCTCTGAAGTTATGCTCGTAGGATCCGATATTGATCATTTTCAA
CATGATGCCGAGGCTGCGGCTTATACTAGTGGAACGGTTTATTCGACAACAACAACGTCGACGTCACCTTATCGA
CATTCAAGACGTTCTAGGTCTCCGACACCTGCTGTTGATGATGAAGATTATTATATTGTTGGAAGTGAAAGTATA
CATTATACTGGTGTACATGATGATCCCGAAAAAGGTTTGTTCCAAGATCAATATCCAGATTACTTTCCTACCGGA
CACGAAACCACAACAACAACAACAATCCTATACGATCCTCAACCACCCACACCTACATCCCAACAAACCTCTTTA
CCCGAAACACCTTTAGATACTCAACATTTTGGTCCGGCACCTTCGGGAAGAGCTATAAGACGACATAAGACGAAG
AAGAGGGTGGTTTTGACGAATGGGAATTTGGTGGTGAATTTGGAGGTACCGCCGAGGTTGGTTTTGCCGAGGAGG
GGGATGGGGGAGATGATGAAGACGAGGTATATGGCTGTGACTTGTGATCCGGATGAGTTTGAGAGGAATGGGTTT
TTTTTGAGACAGAATGAGAGTGGGAGGAGGACGGAGTTGTTGATTATGATTACGATGTATAATGTGAGTTTTTCT
TTTTGATTCTGGGGATTTTTGTTGATGTGTTGGTGATAGGAAGATGAAGTTTTGTTTTGTCGGACGTTGTATGGT
GTGATGCGAAATATTTCGCATTTATGTACACGTAAGAATTCACAAACCTGGGGTCCAAACGCTTGGGAAAAGGTA
AAACCCTTCTCACCTCTCACAAACCATTCTCAACCCAGTAACCTCAAATTCCAACCAGGTCGTAGTATGCATCAT
AGCCGACGGCCGTAAAAAAATTCATCCACGAGTCCTCGATTGTCTAACTCTCCTCGGGGTCTATCAAGCTGGTGG
ACACATGAAAAACATGGTGAATGAAAAACAAGTGACGGCACATGTATTTGAATATACGACTTCGTTTGCGTTGGA
TCCGAATTTACATTTCAAGTTTCCGGATAAGGGGATTGTGCCGACGCAGATTATATTTTGTATGAAGGAGAAGAA
TCAGAAGAAGATTAATAGTCATAGATGGGGGTTTAATGCTTTTGGAGCTATGCTTCAGGTGAGTATTGGTTTATC
TTTTTTTGAGAGAGAGAGAGAGAGAAATTGATTGAGAGAGTGTGTTGGTAGCCGAATGTGTGTGTGTTGTTGGAT
GTGGGGACGAGGCCGGGGAGTAATAGTATTTATAGGTTGTGGAAGGCTTTTGATTTGAATTCGAATGTGGGAGGG
GCTTGTGGAGAGATTTCGGTGTATAAAGGCAAGAATTGGTCGGCGCTTTTGAATCCGTTGGGTACGTTTCAAAAA
TTCAGAATTATTTCCGCTTGATGTCTAATGCTTCCGCAACTTTTTATTTTTATATAAGTCGCGGCGCAGAATTTT
GAGTACAAGATTAGTTGTATTCTGGATAAACCGACGGAAAGTCTGTTTGGATATATCAGTGTATTGGTAGGCATT
TTCTTTCTTTGTTGTACTGGGGAGGACATCTTTCTTACGACTGGTTTCGGTTGGTGACAGCCAGGAGCATTTTCA
GCGTATAGGTATATCGCGTTACAAAATAATGAGCGGGGACAAGGTCCGCTTGCGTCGTATTTTAAAGGCGAGGTT
TTACATGGAAGAGATACCGATATTTTTACTTCTAATATGTGTGAGTCTATCGAGTCAATGGCATTTTGATCGAGC
TGATTTGCTTGTAGATCTTGCTGAAGATGTAGGTCAAGAGGGTGTATTCTACTAGGAGATTTTGAAAAATGACGA
CGTCTCGTTTTTTAGCGTATTCTTTGTTTTGAGCTGGTAGCCAAAGCCAACACAAACTGGTATGCACTTTTTCCT
TTTTTTTTTTTTGTCTTTTTCGTTTACCTTACTCGCACTTCTCAAGGGTCCTGAAATATGTTAAAGGTGCAATTG
GAGAAACGGATGTTCCGGATTCGTTACCCGAGTTTATTTCTCAGAGACGGAGGTGGTTGAATGGGTCTTTTTTTG
CTGCTACTTATGCTATTGCGCATGTTGGACAGATTATGCGGTCGGGACATAGTTTGACGAGGAAAGTTGTGTTGA
TGGTGGAGACGGTGTATAATATCATTAATTTGATTTTTGCGTGGTTCAGTATTGTGAGTTTCCTTTCTTTTTCTT
TTCCTTTCTTGAGTAGTAATTGACTTTTTTGGTGGAAGGGAAACTTTTATCTCTTTTTTGTGAGTTCAGGTTGGT
TCCTTCGGATATGGGATCATGATTTGACTGTGTATGATAAGGTTGTTTTGACGTCTTCACTTGAGGATCCGTCTT
TCAACCTGAAAGGGATTAAATACTTCAATACGTTTATGCAATATCTCATGGGTTCGATGATAGTAGCAAGTTTTA
TATTTTCTATGGGGAACCGCCCTGCTGCGTGCGTTTTTTCTGAACTACTTACCTTTCTCTGGAACTATTCATTGA
TTATTCTTTAGGTCTAAAGCAAAATATAAAACGACCAGTATCGTTTTAGCTATATTGATGCTGTATATGATTATC
GGATCTGTGGCATGCGCTATAGAAGCCGCTCGACAGGGAGGAGCTGCGAATTCGATTATGTTGTTGAGTGTATTG
GTTACTTATGGCCGTAAGTGATTTTGGAGTTTGATTTCTTGTGGTGTTTGATGATCTGATTTGTGGTTTTGTAGT
ATATGCTTTGAGCAGTTTATTGGCTTTTGATCCTTGGCATATGATCACCAGTTTTATTCCTTATATATTCCTTTC
ACCGACTTATATTAATGTTTTGAATGTGTTCGTGATTTCGCGTCGTTGTTCGTTGATGTGGGTTGATTAACGTAT
CGTTCTTTTTTAGCTATGCGTTCTCCAATCTGGATGATGTGAGCTGGCTTCTGTTCAAGTCCCTGTTTCCGAGCG
CTGACAATGTTATTCGTTTATAGATTTCTTGGGGTACAAAGGAGGACAACACTCCTGATACTGACCTTGGCGCTG
TGACGCAAGATATCAATTATCAAGTAGATGTAGAGCTCTTTTCAGATACCGCAGATGTCAACTCGGTTTATGAAG
AAGCATTGACTAACCTTCGGGATCGAAAACCTGTACCGGGAGCTGATAGAAAACATCGAATGAAGACGGATGCGG
AAAAGGAACAAGCTGCTAAAGATTATTATGCGAGTGTTCGTACGAATTTGTTGTTGGCTTGGGTGTTATCGAATG
TAAGTCTTTTTTTGGATGGGTTGACCGCATGGCCAAAGTTTTGCGGTTTCTGATTTGGATTCTTTTATGGGTGGC
GTTGACAGGGGTTATTGTTGTTGGCTATTCTTGGTGGTGTTTCTGCGACGAATACGTTTGATCGTGATGCTGGGG
TGAATAGGACGAAAGGGTATTTGATATTTATCCTTTCGTTTACTGCGATTACGAATTCGGTGGTGCGTGAATTTC
TTTGACTCCTTTTTTCATGCTCAATGAGTTGTTTTTGATCAGCGTTTTGGTGGTTCGACATTGTACCTTATGGCT
CGATTGATTACTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail