Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041160
Gene name
Locationscaffold_2:695603..696728
Strand-
Gene length (bp)1125
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 2.5E-11 152 215
PF01713 Smr Smr domain 1.8E-10 223 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 149 298 1.0E-24
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 176 296 2.0E-16
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 150 296 2.0E-06
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 152 262 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 178.59 105.65 251.53
Initials Initials knots 154.12 92.52 215.71
Pileal_Stipeal_center Stage I stipe center 190.13 112.86 267.41
Pileal_Stipeal_shell Stage I stipe shell 88.05 51.44 124.65
DIF_stipe_center Stage II stipe center 183.08 109.01 257.15
DIF_stipe_shell Stage II stipe shell 252.52 148.22 356.82
DIF_stipe_skin Stage II stipe skin 221.39 130.72 312.05
DIF_cap_skin Stage II cap skin 64.98 37.78 92.18
DIF_cap_tissue Stage II cap tissue 82.20 48.86 115.54
DIF_gill_tissue Stage II gill tissue 100.75 60.01 141.50
YFB_stipe_center Young fruiting body stipe center 159.78 96.09 223.47
YFB_stipe_shell Young fruiting body stipe shell 177.37 105.61 249.13
YFB_stipe_skin Young fruiting body stipe skin 166.95 100.28 233.62
YFB_cap_skin Young fruiting body cap skin 78.17 46.33 110.00
YFB_cap_tissue Young fruiting body cap tissue 95.89 57.12 134.66
YFB_gill_tissue Young fruiting body gill tissue 92.95 55.02 130.88
YFB_veil Young fruiting body veil 98.15 57.53 138.76

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.034837 yes
Casing YFB_stipe_center 0.806808 no
Casing YFB_stipe_shell 0.989895 no
Casing YFB_stipe_skin 0.894211 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.021846 yes
Casing YFB_gill_tissue 0.013485 yes
Casing YFB_veil 0.026461 yes
Casing Initials 0.720417 no
Casing Pileal_Stipeal_center 0.902139 no
Casing Pileal_Stipeal_shell 0.004160 yes
Casing DIF_stipe_center 0.964132 no
Casing DIF_stipe_shell 0.276906 no
Casing DIF_stipe_skin 0.563298 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.095478 no
DIF_gill_tissue YFB_stipe_shell 0.033674 yes
DIF_gill_tissue YFB_stipe_skin 0.064141 no
DIF_gill_tissue YFB_cap_skin 0.457204 no
DIF_gill_tissue YFB_cap_tissue 0.926929 no
DIF_gill_tissue YFB_gill_tissue 0.872742 no
DIF_gill_tissue YFB_veil 0.960732 no
YFB_stipe_center YFB_stipe_shell 0.815431 no
YFB_stipe_center YFB_stipe_skin 0.934697 no
YFB_stipe_center YFB_cap_skin 0.003765 yes
YFB_stipe_center YFB_cap_tissue 0.059513 no
YFB_stipe_center YFB_gill_tissue 0.038495 yes
YFB_stipe_center YFB_veil 0.070681 no
YFB_stipe_shell YFB_stipe_skin 0.906368 no
YFB_stipe_shell YFB_cap_skin 0.001140 yes
YFB_stipe_shell YFB_cap_tissue 0.017226 yes
YFB_stipe_shell YFB_gill_tissue 0.011350 yes
YFB_stipe_shell YFB_veil 0.025458 yes
YFB_stipe_skin YFB_cap_skin 0.001140 yes
YFB_stipe_skin YFB_cap_tissue 0.039836 yes
YFB_stipe_skin YFB_gill_tissue 0.022631 yes
YFB_stipe_skin YFB_veil 0.048422 yes
YFB_cap_skin YFB_cap_tissue 0.589880 no
YFB_cap_skin YFB_gill_tissue 0.658639 no
YFB_cap_skin YFB_veil 0.526108 no
YFB_cap_tissue YFB_gill_tissue 0.954131 no
YFB_cap_tissue YFB_veil 0.965238 no
YFB_gill_tissue YFB_veil 0.916737 no
Initials DIF_gill_tissue 0.133562 no
Initials YFB_stipe_center 0.946555 no
Initials YFB_stipe_shell 0.733331 no
Initials YFB_stipe_skin 0.868518 no
Initials YFB_cap_skin 0.009123 yes
Initials YFB_cap_tissue 0.089469 no
Initials YFB_gill_tissue 0.059906 no
Initials YFB_veil 0.107449 no
Initials Pileal_Stipeal_center 0.562521 no
Initials Pileal_Stipeal_shell 0.034604 yes
Initials DIF_stipe_center 0.662953 no
Initials DIF_stipe_shell 0.072862 no
Initials DIF_stipe_skin 0.233318 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.013782 yes
Pileal_Stipeal_center DIF_gill_tissue 0.016386 yes
Pileal_Stipeal_center YFB_stipe_center 0.652372 no
Pileal_Stipeal_center YFB_stipe_shell 0.888742 no
Pileal_Stipeal_center YFB_stipe_skin 0.759468 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.008457 yes
Pileal_Stipeal_center YFB_gill_tissue 0.006032 yes
Pileal_Stipeal_center YFB_veil 0.012274 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.001140 yes
Pileal_Stipeal_center DIF_stipe_center 0.945585 no
Pileal_Stipeal_center DIF_stipe_shell 0.395048 no
Pileal_Stipeal_center DIF_stipe_skin 0.712762 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.758436 no
Pileal_Stipeal_shell YFB_stipe_center 0.025711 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.006032 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.011968 yes
Pileal_Stipeal_shell YFB_cap_skin 0.791621 no
Pileal_Stipeal_shell YFB_cap_tissue 0.863291 no
Pileal_Stipeal_shell YFB_gill_tissue 0.918111 no
Pileal_Stipeal_shell YFB_veil 0.814191 no
Pileal_Stipeal_shell DIF_stipe_center 0.004548 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.359267 no
Pileal_Stipeal_shell DIF_cap_tissue 0.893549 no
DIF_stipe_center DIF_gill_tissue 0.026215 yes
DIF_stipe_center YFB_stipe_center 0.750732 no
DIF_stipe_center YFB_stipe_shell 0.953485 no
DIF_stipe_center YFB_stipe_skin 0.847023 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.011350 yes
DIF_stipe_center YFB_gill_tissue 0.007439 yes
DIF_stipe_center YFB_veil 0.017783 yes
DIF_stipe_center DIF_stipe_shell 0.317243 no
DIF_stipe_center DIF_stipe_skin 0.625304 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.101862 no
DIF_stipe_shell YFB_stipe_shell 0.259385 no
DIF_stipe_shell YFB_stipe_skin 0.154113 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.768896 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.001140 yes
DIF_stipe_skin YFB_stipe_center 0.290462 no
DIF_stipe_skin YFB_stipe_shell 0.546875 no
DIF_stipe_skin YFB_stipe_skin 0.391043 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.001625 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.130393 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.640072 no
DIF_cap_skin YFB_cap_tissue 0.194842 no
DIF_cap_skin YFB_gill_tissue 0.242880 no
DIF_cap_skin YFB_veil 0.165288 no
DIF_cap_skin DIF_cap_tissue 0.511724 no
DIF_cap_tissue DIF_gill_tissue 0.588429 no
DIF_cap_tissue YFB_stipe_center 0.010093 yes
DIF_cap_tissue YFB_stipe_shell 0.002525 yes
DIF_cap_tissue YFB_stipe_skin 0.002951 yes
DIF_cap_tissue YFB_cap_skin 0.926055 no
DIF_cap_tissue YFB_cap_tissue 0.709873 no
DIF_cap_tissue YFB_gill_tissue 0.780028 no
DIF_cap_tissue YFB_veil 0.648885 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041160
MPFFKPLLLLATFYGVCKLGSYLFGDDSPPPPPPPSPPSYPRSRSRSPRRAPRLGGQHAQAPSPHRCSSSCRAGR
HVYQAQPPTTLQPQRRPVKTVSEHQPLSPQNVGQHHSRVESSPITDPYRSHDHHNPQVEPVRNAGASNKDDERDP
HYVHLRNEAKKYYGLMIEARDGSKIARDQGNRALARELSSKRTEYSDLMESYHEQASEWIFYQLNRNNDPGEVDL
HGLFVKEAIPRVERKLKEARARGAPSIRFIVGQGRHSDDGIPKLKPAIENLIRESGLSSRIEQFNPGALIVDFDS
HSESRGRDYLRDRTNQG*
Coding >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGATGATGAGCGAGATCCG
CATTATGTCCACCTTCGCAATGAGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATT
GCTCGCGACCAAGGCAATCGTGCTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAA
AGTTATCATGAACAGGCCAGTGAATGGATATTTTACCAGCTCAACAGAAACAATGACCCAGGCGAAGTGGATTTA
CACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAAGCTCGAGCGCGAGGTGCTCCA
TCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAACTCAAACCTGCGATCGAAAAT
TTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCCTTGATAGTCGACTTTGATTCT
CACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA
Transcript >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGATGATGAGCGAGATCCG
CATTATGTCCACCTTCGCAATGAGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATT
GCTCGCGACCAAGGCAATCGTGCTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAA
AGTTATCATGAACAGGCCAGTGAATGGATATTTTACCAGCTCAACAGAAACAATGACCCAGGCGAAGTGGATTTA
CACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAAGCTCGAGCGCGAGGTGCTCCA
TCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAACTCAAACCTGCGATCGAAAAT
TTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCCTTGATAGTCGACTTTGATTCT
CACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA
Gene >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGTCTGCCTGTCGAAACCT
TATTTTTATGAGCATTCAGTTGATCGTTATGTTAGGATGATGAGCGAGATCCGCATTATGTCCACCTTCGCAATG
AGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATTGCTCGCGACCAAGGCAATCGTG
CTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAAAGTTATCATGAACAGGCCAGTG
AATGGATATTTTACCGTAAGTTTTCGTCCCACTGATTTCAATCCGCGTTCTGATCCGAAAATCCGTCCTTAGAGC
TCAACAGAGTTCGTGGATTATCTTCCTATTCGCTTCCGCTGTGTGTACTCAATGATCACCATTCATCAGAACAAT
GACCCAGGCGAAGTGGATTTACACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAA
GCTCGAGCGCGAGGTGCTCCATCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAA
CTCAAACCTGCGATCGAAAATTTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCC
TTGATAGTCGACTTTGATTCTCACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail