Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041160
Gene name
Locationscaffold_2:695603..696728
Strand-
Gene length (bp)1125
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 2.5E-11 152 215
PF01713 Smr Smr domain 1.8E-10 223 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 149 298 1.0E-24
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 176 296 2.0E-16
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 150 296 2.0E-06
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 152 262 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041160
MPFFKPLLLLATFYGVCKLGSYLFGDDSPPPPPPPSPPSYPRSRSRSPRRAPRLGGQHAQAPSPHRCSSSCRAGR
HVYQAQPPTTLQPQRRPVKTVSEHQPLSPQNVGQHHSRVESSPITDPYRSHDHHNPQVEPVRNAGASNKDDERDP
HYVHLRNEAKKYYGLMIEARDGSKIARDQGNRALARELSSKRTEYSDLMESYHEQASEWIFYQLNRNNDPGEVDL
HGLFVKEAIPRVERKLKEARARGAPSIRFIVGQGRHSDDGIPKLKPAIENLIRESGLSSRIEQFNPGALIVDFDS
HSESRGRDYLRDRTNQG*
Coding >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGATGATGAGCGAGATCCG
CATTATGTCCACCTTCGCAATGAGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATT
GCTCGCGACCAAGGCAATCGTGCTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAA
AGTTATCATGAACAGGCCAGTGAATGGATATTTTACCAGCTCAACAGAAACAATGACCCAGGCGAAGTGGATTTA
CACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAAGCTCGAGCGCGAGGTGCTCCA
TCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAACTCAAACCTGCGATCGAAAAT
TTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCCTTGATAGTCGACTTTGATTCT
CACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA
Transcript >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGATGATGAGCGAGATCCG
CATTATGTCCACCTTCGCAATGAGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATT
GCTCGCGACCAAGGCAATCGTGCTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAA
AGTTATCATGAACAGGCCAGTGAATGGATATTTTACCAGCTCAACAGAAACAATGACCCAGGCGAAGTGGATTTA
CACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAAGCTCGAGCGCGAGGTGCTCCA
TCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAACTCAAACCTGCGATCGAAAAT
TTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCCTTGATAGTCGACTTTGATTCT
CACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA
Gene >AgabiH97|041160
ATGCCTTTCTTCAAACCGTTGTTGTTGTTGGCCACTTTCTATGGTGTTTGTAAACTCGGCTCCTATTTATTCGGT
GATGACTCTCCGCCCCCTCCACCACCACCCTCTCCACCATCTTATCCCCGATCACGTTCACGTTCACCTCGACGA
GCTCCGAGACTCGGAGGCCAACATGCACAGGCGCCATCTCCACACCGATGCTCTTCCTCTTGTCGTGCCGGTCGA
CACGTCTACCAAGCCCAACCACCAACCACCCTACAGCCTCAACGCCGACCCGTAAAGACTGTATCAGAGCACCAG
CCTCTTTCTCCCCAAAACGTGGGGCAACATCACTCCCGAGTCGAGTCCTCCCCCATAACGGATCCATATCGATCC
CATGACCATCATAACCCGCAAGTAGAACCTGTTCGCAACGCCGGAGCATCCAATAAGGTCTGCCTGTCGAAACCT
TATTTTTATGAGCATTCAGTTGATCGTTATGTTAGGATGATGAGCGAGATCCGCATTATGTCCACCTTCGCAATG
AGGCAAAGAAGTACTACGGTCTCATGATTGAGGCCCGTGACGGGAGTAAAATTGCTCGCGACCAAGGCAATCGTG
CTCTAGCCAGAGAATTGTCCAGTAAACGTACTGAGTATAGTGACCTCATGGAAAGTTATCATGAACAGGCCAGTG
AATGGATATTTTACCGTAAGTTTTCGTCCCACTGATTTCAATCCGCGTTCTGATCCGAAAATCCGTCCTTAGAGC
TCAACAGAGTTCGTGGATTATCTTCCTATTCGCTTCCGCTGTGTGTACTCAATGATCACCATTCATCAGAACAAT
GACCCAGGCGAAGTGGATTTACACGGATTATTCGTTAAAGAAGCTATTCCTCGAGTAGAGCGAAAACTCAAAGAA
GCTCGAGCGCGAGGTGCTCCATCCATCCGATTCATCGTTGGACAAGGCCGCCATTCGGATGATGGCATTCCTAAA
CTCAAACCTGCGATCGAAAATTTGATCCGAGAGTCAGGGCTTTCCTCGAGAATCGAGCAGTTCAATCCGGGTGCC
TTGATAGTCGACTTTGATTCTCACTCAGAATCTAGAGGTCGTGATTATCTCCGCGACAGGACTAATCAGGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail