Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041140
Gene name
Locationscaffold_2:690883..693945
Strand-
Gene length (bp)3062
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 7.6E-38 824 926
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.6E-37 796 892
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 9.3E-11 645 730
PF08284 RVP_2 Retroviral aspartyl protease 2.1E-09 371 469
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 3.3E-08 364 454
PF13650 Asp_protease_2 Aspartyl protease 7.8E-07 362 452
PF00098 zf-CCHC Zinc knuckle 3.6E-04 306 321
PF03732 Retrotrans_gag Retrotransposon gag protein 1.5E-06 136 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 367 948 2.0E-76
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 367 948 2.0E-76
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 367 948 2.0E-76
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 367 948 2.0E-76
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 367 948 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 367 948 2.0E-76
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 367 948 2.0E-76
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 367 948 2.0E-76
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 367 948 2.0E-76
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 367 948 2.0E-76
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 367 948 2.0E-76
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 367 948 2.0E-76
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 367 948 2.0E-76
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 367 948 6.0E-76
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 367 948 6.0E-76
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 367 948 8.0E-76
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 528 947 2.0E-72
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 528 947 7.0E-71
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 555 953 5.0E-68
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 555 953 1.0E-67
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 545 947 1.0E-59
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 441 946 4.0E-52
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 550 947 9.0E-49
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 354 946 2.0E-36
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 354 946 7.0E-36
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 550 946 1.0E-35
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 354 946 1.0E-35
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 548 944 2.0E-35
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 354 946 4.0E-35
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 354 946 6.0E-34
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 302 946 2.0E-31
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 302 946 4.0E-31
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 368 941 3.0E-30
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 557 948 3.0E-28
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 367 941 5.0E-26
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 359 934 4.0E-25
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 585 952 4.0E-23
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 550 859 8.0E-22
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 548 876 7.0E-21
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 548 876 7.0E-21
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 550 859 7.0E-21
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 548 876 7.0E-21
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 548 876 1.0E-20
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 546 876 2.0E-20
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 548 876 2.0E-20
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 548 876 1.0E-19
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 548 876 2.0E-19
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 373 881 2.0E-19
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 648 900 3.0E-19
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 370 946 3.0E-19
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 578 946 3.0E-19
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 548 876 4.0E-19
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 538 946 4.0E-18
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 307 775 2.0E-17
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 505 881 2.0E-17
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 535 880 6.0E-17
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 703 845 1.0E-16
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 536 880 7.0E-15
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 535 880 2.0E-14
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 356 880 2.0E-12
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 356 882 2.0E-12
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 734 859 1.0E-11
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 69 476 1.0E-11
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 547 812 8.0E-11
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 547 812 3.0E-10
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 547 812 5.0E-10
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 598 673 8.0E-10
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 752 859 4.0E-09
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 278 687 7.0E-08
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 272 333 2.0E-07
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 275 330 5.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 273 320 1.0E-06
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 275 325 2.0E-06
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 278 323 2.0E-06
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 278 323 2.0E-06
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 275 323 4.0E-06
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 275 323 4.0E-06
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 278 322 5.0E-06
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 276 687 6.0E-06
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 246 326 6.0E-06
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 275 322 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041140
MSTERNDYDSLDEEHYERVARSTRRNQNRKNQKKRQPVDFRSYRDTRNPIDTESENENTIDTDDQNTRDNDNMSN
DAAVTVSAPTDALKSLIPNPKDFGGNREQFAEWWMNMTLFLKYNKVTDTDQKIIATIKLASSITYTWDSFEEEIK
TSFGKGNEKDLAEERIESLKQGNRNTMDFLVEFTALMYKSKIDDQHAIFLLRRHTRHDIIKTILGYPRKDIPETR
EDWNNAILQVGSGLETMKRIDHRTETGVTYGGSGQPMEIGWKKFEWDKDGKPKCHKCGKFGHIGKNCEEKKKNFG
EKKSFKCFSCGKFGHIAKNCRNNRSGRIRAMNEDSDDEDDSKNEQGFSDGVQELEVKPLLTTTNGKKLKVSAMVD
SGCTHTCIDEGLVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFAKIDININGHNEQLNAVVTPLQSSDLFLGH
DWLTNHNPEINWKQGIIKFNRCPTSCSFPHTDISFEPRIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNKK
NFDKLPERTEWDHEVNFTENAPTEISSKVYSMTPLEREELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLR
LCQDYRKLNEITIKDKTPLPLISEVLDQLKDAKVFNKLDIIWGLFEPTVMFFGMSNSPATFSRMMATIFREMIQD
GSLANYMDDFIIPAKDDEELEARTLRFLKIAEKHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDW
AVPTTVKQVESFLGFANFYRRFIKNFSTIAQPLNELKSKKGEKWYWNDEQQQAFEQIKQAIASEPVLALPKDKGQ
FRVEVDASNYGTGAVLSQEQEDKWHPVAFMSKTLSEAERNYEIYDKELLAIIKALKLWRHYLLDAKEQFEIWTDH
ENLKYFREPQKLNAQQARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSNC*
Coding >AgabiH97|041140
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGA
AACCAGAACAGGAAGAACCAGAAGAAACGACAACCAGTTGACTTTAGGAGTTACAGAGACACTAGGAACCCCATC
GACACAGAGTCAGAGAACGAGAACACCATCGACACAGACGATCAGAACACCCGAGACAACGACAACATGAGCAAC
GACGCCGCCGTAACCGTTAGTGCACCGACAGATGCACTCAAGTCGCTTATCCCGAACCCGAAGGATTTTGGGGGG
AATAGAGAGCAGTTTGCAGAATGGTGGATGAATATGACACTTTTCCTGAAGTACAACAAGGTCACGGACACCGAC
CAGAAGATCATCGCCACCATCAAACTCGCCAGCAGCATCACATACACATGGGATAGTTTTGAAGAAGAAATCAAG
ACTTCATTCGGAAAAGGAAACGAGAAGGATTTAGCAGAGGAAAGGATCGAATCCCTCAAACAAGGAAACAGGAAC
ACCATGGACTTCCTAGTCGAATTCACAGCTCTCATGTACAAATCCAAAATCGACGACCAACACGCCATATTCCTC
CTTAGACGTCACACCCGTCACGATATTATCAAGACGATTTTGGGATACCCAAGGAAAGATATTCCGGAGACGAGA
GAAGACTGGAATAACGCAATTTTACAAGTTGGGTCAGGACTAGAGACGATGAAAAGGATTGATCATAGGACCGAA
ACTGGAGTCACTTACGGAGGAAGTGGACAACCAATGGAGATAGGATGGAAGAAATTCGAGTGGGACAAGGATGGA
AAACCCAAATGTCACAAATGCGGAAAGTTCGGACACATCGGGAAGAACTGTGAAGAGAAGAAGAAGAATTTTGGA
GAGAAGAAGAGCTTCAAGTGTTTCAGTTGTGGGAAATTTGGACATATTGCGAAGAATTGCCGAAACAACAGGAGT
GGAAGGATTAGAGCAATGAATGAGGATTCTGACGATGAAGACGACTCCAAGAACGAGCAGGGTTTTTCCGATGGA
GTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACAACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGAC
TCGGGATGCACACACACATGTATCGACGAAGGATTAGTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGG
CCGATCACATGCAGGAATTCAGATGGAACGATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAAATAGACATA
AACATCAACGGTCATAATGAACAACTGAACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCAT
GATTGGTTAACGAACCACAACCCCGAAATCAATTGGAAACAAGGAATTATCAAGTTCAACCGGTGCCCCACATCA
TGTTCTTTTCCCCATACCGACATCTCTTTTGAACCACGTATACGACGATTACAATCAAACGAAGACACTGAGGAA
AAAGAACCGGATCCAACAAACCCTGAAGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAG
AACTTCGACAAACTACCTGAACGGACGGAATGGGATCACGAAGTTAACTTCACAGAAAACGCACCAACGGAGATA
TCATCAAAGGTTTATAGCATGACACCACTGGAGAGAGAAGAACTGGACAAATTCTTGGACGAAAACCTGGCTACC
AATCGAATCCGACCATCGAAATCACCCTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGG
TTATGTCAGGATTATAGGAAACTGAACGAAATCACGATCAAGGACAAGACACCACTACCCCTCATCAGTGAAGTA
TTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGACATTATCTGGGGATTATTTGAACCAACGGTCATG
TTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGAC
GGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTTTA
CGTTTTCTCAAAATCGCGGAGAAACACAATTTATCTTTCAAACGGACGAAATGCGAGTTCAATGTTTCATCAACA
ACGGTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGG
GCGGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAAAAT
TTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAA
CAACAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGGTCTTAGCATTACCCAAGGACAAAGGACAA
TTCAGAGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCAC
CCGGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTACGAAATCTACGACAAGGAACTACTAGCT
ATCATAAAAGCTTTGAAACTATGGCGACACTATCTATTGGACGCAAAGGAGCAATTTGAGATATGGACAGATCAC
GAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCAACAAGCAAGATGGTACCTCATGCTACAGGAA
TATGATTTCCTTCTACGACACATTCCTGGGAAGACAAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCT
GACACATCTAACTGTTAG
Transcript >AgabiH97|041140
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGA
AACCAGAACAGGAAGAACCAGAAGAAACGACAACCAGTTGACTTTAGGAGTTACAGAGACACTAGGAACCCCATC
GACACAGAGTCAGAGAACGAGAACACCATCGACACAGACGATCAGAACACCCGAGACAACGACAACATGAGCAAC
GACGCCGCCGTAACCGTTAGTGCACCGACAGATGCACTCAAGTCGCTTATCCCGAACCCGAAGGATTTTGGGGGG
AATAGAGAGCAGTTTGCAGAATGGTGGATGAATATGACACTTTTCCTGAAGTACAACAAGGTCACGGACACCGAC
CAGAAGATCATCGCCACCATCAAACTCGCCAGCAGCATCACATACACATGGGATAGTTTTGAAGAAGAAATCAAG
ACTTCATTCGGAAAAGGAAACGAGAAGGATTTAGCAGAGGAAAGGATCGAATCCCTCAAACAAGGAAACAGGAAC
ACCATGGACTTCCTAGTCGAATTCACAGCTCTCATGTACAAATCCAAAATCGACGACCAACACGCCATATTCCTC
CTTAGACGTCACACCCGTCACGATATTATCAAGACGATTTTGGGATACCCAAGGAAAGATATTCCGGAGACGAGA
GAAGACTGGAATAACGCAATTTTACAAGTTGGGTCAGGACTAGAGACGATGAAAAGGATTGATCATAGGACCGAA
ACTGGAGTCACTTACGGAGGAAGTGGACAACCAATGGAGATAGGATGGAAGAAATTCGAGTGGGACAAGGATGGA
AAACCCAAATGTCACAAATGCGGAAAGTTCGGACACATCGGGAAGAACTGTGAAGAGAAGAAGAAGAATTTTGGA
GAGAAGAAGAGCTTCAAGTGTTTCAGTTGTGGGAAATTTGGACATATTGCGAAGAATTGCCGAAACAACAGGAGT
GGAAGGATTAGAGCAATGAATGAGGATTCTGACGATGAAGACGACTCCAAGAACGAGCAGGGTTTTTCCGATGGA
GTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACAACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGAC
TCGGGATGCACACACACATGTATCGACGAAGGATTAGTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGG
CCGATCACATGCAGGAATTCAGATGGAACGATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAAATAGACATA
AACATCAACGGTCATAATGAACAACTGAACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCAT
GATTGGTTAACGAACCACAACCCCGAAATCAATTGGAAACAAGGAATTATCAAGTTCAACCGGTGCCCCACATCA
TGTTCTTTTCCCCATACCGACATCTCTTTTGAACCACGTATACGACGATTACAATCAAACGAAGACACTGAGGAA
AAAGAACCGGATCCAACAAACCCTGAAGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAG
AACTTCGACAAACTACCTGAACGGACGGAATGGGATCACGAAGTTAACTTCACAGAAAACGCACCAACGGAGATA
TCATCAAAGGTTTATAGCATGACACCACTGGAGAGAGAAGAACTGGACAAATTCTTGGACGAAAACCTGGCTACC
AATCGAATCCGACCATCGAAATCACCCTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGG
TTATGTCAGGATTATAGGAAACTGAACGAAATCACGATCAAGGACAAGACACCACTACCCCTCATCAGTGAAGTA
TTAGATCAACTCAAAGACGCCAAGGTTTTCAACAAATTGGACATTATCTGGGGATTATTTGAACCAACGGTCATG
TTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGAC
GGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTTTA
CGTTTTCTCAAAATCGCGGAGAAACACAATTTATCTTTCAAACGGACGAAATGCGAGTTCAATGTTTCATCAACA
ACGGTATTAGGAACGGTTATTGGGAATGGAAAGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGG
GCGGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAAAAT
TTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAA
CAACAAGCTTTCGAACAAATCAAGCAAGCTATCGCCAGCGAACCGGTCTTAGCATTACCCAAGGACAAAGGACAA
TTCAGAGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCAC
CCGGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTACGAAATCTACGACAAGGAACTACTAGCT
ATCATAAAAGCTTTGAAACTATGGCGACACTATCTATTGGACGCAAAGGAGCAATTTGAGATATGGACAGATCAC
GAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCAACAAGCAAGATGGTACCTCATGCTACAGGAA
TATGATTTCCTTCTACGACACATTCCTGGGAAGACAAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCT
GACACATCTAACTGTTAG
Gene >AgabiH97|041140
ATGAGCACAGAGAGAAACGACTACGACAGTCTAGACGAAGAACACTACGAACGAGTAGCCAGATCTACTAGGAGA
AACCAGAACAGGAAGAACCAGAAGAAACGACAACCAGTTGACTTTAGGAGTTACAGAGACACTAGGAACCCCATC
GACACAGAGTCAGAGAACGAGAACACCATCGACACAGACGATCAGAACACCCGAGACAACGACAACATGAGCAAC
GACGCCGCCGTAACCGTTAGTGCACCGACAGATGCACTCAAGTCGCTTATCCCGAACCCGAAGGATTTTGGGGGG
AATAGAGAGCAGTTTGCAGAATGGTGGATGAATATGACACTTTTCCTGAAGTACAACAAGGTCACGGACACCGAC
CAGAAGATCATCGCCACCATCGTATGATTGAAAGGACCTATCCCCAGCTACTTTGCCGAAGTATGGACGGAGAAA
CTCGCCAGCAGCATCACATACACATGGGATAGTTTTGAAGAAGAAATCAAGACTTCATTCGGAAAAGGAAACGAG
AAGGATTTAGCAGAGGAAAGGATCGAATCCCTCAAACAAGGAAACAGGAACACCATGGACTTCCTAGTCGAATTC
ACAGCTCTCATGTACAAATCCAAAATCGACGACCAACACGCCATATTCCTCCTTAGACGTCACACCCGTCACGAT
ATTATCAAGACGATTTTGGGATACCCAAGGAAAGATATTCCGGAGACGAGAGAAGACTGGAATAACGCAATTTTA
CAAGTTGGGTCAGGACTAGAGACGATGAAAAGGATTGATCATAGGACCGAAACTGGAGTCACTTACGGAGGAAGT
GGACAACCAATGGAGATAGGATGGAAGAAATTCGAGTGGGACAAGGATGGAAAACCCAAATGTCACAAATGCGGA
AAGTTCGGACACATCGGGAAGAACTGTGAAGAGAAGAAGAAGAATTTTGGAGAGAAGAAGAGCTTCAAGTGTTTC
AGTTGTGGGAAATTTGGACATATTGCGAAGAATTGCCGAAACAACAGGAGTGGAAGGATTAGAGCAATGAATGAG
GATTCTGACGATGAAGACGACTCCAAGAACGAGCAGGGTTTTTCCGATGGTTCCGAGTAGGCACGACCTCGCGAA
CCAATGTACCTAGACAAATGAACAATTGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAA
AACCCCTCCTCACTACAACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACAT
GTATCGACGAAGGATTAGTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGGCCGATCACATGCAGGAATT
CAGATGGAACGATAGCAGGAAAGAAAGATATCACTAAATTCGCGAAAATAGACATAAACATCAACGGTCATAATG
AACAACTGAACGCGGTCGTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACA
ACCCCGAAATCAATTGGAAACAAGGAATTATCAAGTTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCG
ACATCTCTTTTGAACCACGTATACGACGATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACAA
ACCCTGAAGACTTACCAGCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAGAACTTCGACAAACTACCTG
AACGGACGGAATGGGATCACGAAGTTAACTTCACAGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCA
TGACACCACTGGAGAGAGAAGAACTGGACAAATTCTTGGACGAAAACCTGGCTACCAATCGAATCCGACCATCGA
AATCACCCTATGCAGCACCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGA
AACTGAACGAAATCACGATCAAGGACAAGACACCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAAAGACG
CCAAGGTTTTCAACAAATTGGACATTATCTGGGGGTATAACAACGTTCGGATATGAGAAGGAGATGAATGGAAAG
CAGCATTCTTGACGAATCGCAGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCT
TCTCACGTATGATGGCGACAATCTTTCGAGAAATGATACAGGACGGATCTTTAGCCAACTACATGGACGATTTCA
TCATTCCAGCAAAGGACGATGAAGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATT
TATCTTTCAAACGGACGAAATGCGAGTTCAATGTTTCATCAACAACGGTATTAGGAACGGTTATTGGGAATGGAA
AGGCAACAATGGAAGAAGAAAAGGTCAAGGCAATACGAGATTGGGCGGTCCCTACCACGGTCAAACAAGTCGAAA
GCTTTTTAGGTTTTGCCAACTTCTATCGACGATTTATCAAAAATTTCAGCACCATCGCGCAACCACTAAACGAGC
TGAAGTCTAAGAAGGGGGAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAGCAAGCTA
TCGCCAGCGAACCGGTCTTAGCATTACCCAAGGACAAAGGACAATTCAGAGTTGAAGTAGACGCATCAAACTATG
GAACAGGAGCAGTACTATCACAGGAACAGGAAGACAAATGGCACCCGGTCGCCTTCATGTCGAAAACATTATCTG
AAGCCGAACGAAACTACGAAATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTGAAACTATGGCGACACT
ATCTATTGGACGCAAAGGAGCAATTTGAGATATGGACAGATCACGAGAACCTCAAATATTTCCGAGAACCTCAAA
AGCTCAACGCTCAACAAGCAAGATGGTACCTCATGCTACAGGAATATGATTTCCTTCTACGACACATTCCTGGGA
AGACAAACACCAAAGCAGACATCCTGTCGAGACTAATCAAACCTGACACATCTAACTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail