Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|041000
Gene name
Locationscaffold_2:654821..656818
Strand-
Gene length (bp)1997
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01713 Smr Smr domain 1.7E-07 545 602

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 458 620 3.0E-13
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 471 604 3.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|041000
MDIVFSIAAGLGLRVYLVRATSPASVIAPAIIGLFEGVLTHQLSFRPTSSVSSPPLDHYLALGLRLAADLLLSKS
LPRLVMIGLWAAIGTIISESAFPSSLSSLNSRVSSSSSRRDKEKRHRHSKASPPRISSRVRVYRSPVISTATSDP
LPPPQTSTPTRPTVQVNTRSTPPSGQTASSPNYLAASPRSFFSDAETQPSPFPDSSASPKPITVVTQFPSRPRSA
LSFYEGENDAASAPEPSGGPGRSPHLLTPPDSTIRERTMDSRVDRLSTIDEITSRSEHVSTEDIDPRELRSEENY
IPISQVNGGGPLPVPNPTSHYVTDSGTPVASLPPILPAPNSPSVPSDEDELRTPGQPVYEVGSESDELRTPPAVQ
ARVLDNGTTASTPQNATRSVVPDNPLSPLMLNSQSDPIAVPGTTLSSYAMLQPPPEPTPPFPIVAPVPARLKVRP
QSPTFSDGESVLSTTNPRELVEHGTDIRKQAKFEESELERLMSELRLADKEKRPRDALFLKEDIRLTRERIAELH
RRAARRHFDGRNNLQKPDTIDVHGLKPDEALFRTEERLRHLLRNGHSTLNVIVGKGLHSPNGVPAVKNHIVREMQ
RQKIPCRVDQFNAGILILTLAPLDS*
Coding >AgabiH97|041000
ATGGACATCGTGTTCTCGATAGCGGCAGGCTTGGGACTCCGAGTCTACCTTGTACGCGCCACTTCCCCAGCGTCG
GTCATTGCTCCAGCTATTATAGGCTTGTTCGAAGGTGTCCTCACCCACCAACTTTCATTCCGCCCTACTTCCTCC
GTTTCTTCGCCGCCTTTGGACCATTACCTGGCACTTGGCCTGCGCCTCGCCGCCGATCTGCTCTTATCCAAAAGT
CTACCAAGACTGGTGATGATTGGTCTGTGGGCCGCCATTGGCACAATTATCTCCGAATCCGCATTTCCCAGTTCC
TTGTCCTCTCTTAACAGCCGTGTCTCCAGCTCTTCCAGCCGCCGAGACAAGGAGAAGCGTCATCGCCACTCTAAA
GCCTCTCCTCCACGTATTTCCTCCCGTGTCCGTGTATATCGGTCGCCTGTCATATCAACTGCCACATCCGACCCT
CTCCCACCGCCACAAACAAGTACGCCTACTCGACCAACGGTTCAAGTCAATACTCGTAGTACACCGCCGTCTGGT
CAAACTGCCTCTTCCCCCAATTACCTAGCTGCCTCACCGCGTAGTTTCTTTTCAGACGCCGAGACACAGCCATCT
CCCTTCCCCGATTCTTCTGCGTCCCCTAAACCCATCACTGTAGTAACCCAGTTTCCATCTCGTCCTCGCTCGGCC
CTATCATTTTATGAAGGGGAGAATGATGCAGCCTCTGCGCCTGAGCCATCAGGTGGCCCAGGACGTTCCCCCCAT
CTGCTAACACCACCTGATAGTACAATACGCGAGAGAACGATGGACTCTCGTGTCGACCGTCTTTCCACCATTGAC
GAAATAACTTCTCGGTCGGAGCACGTCAGCACAGAAGATATCGATCCAAGAGAGCTTCGGAGCGAGGAAAACTAC
ATTCCCATTTCACAAGTTAATGGTGGTGGCCCACTTCCCGTTCCCAATCCCACTAGTCACTATGTAACTGATAGT
GGTACACCAGTTGCTTCTCTCCCACCTATTCTTCCCGCACCGAATAGTCCTAGTGTACCAAGTGATGAAGATGAA
CTTCGGACTCCTGGTCAACCTGTATACGAGGTTGGATCGGAATCGGATGAATTGAGGACACCTCCGGCAGTACAA
GCTCGAGTTCTTGACAATGGTACTACTGCGTCTACACCCCAGAATGCCACCAGATCGGTTGTACCTGACAATCCG
CTTTCACCGCTCATGCTTAATTCTCAATCTGATCCCATTGCGGTCCCTGGAACAACCCTCTCGTCGTACGCGATG
TTACAACCTCCTCCCGAACCTACACCTCCTTTCCCTATCGTCGCCCCAGTTCCTGCAAGACTTAAAGTACGCCCT
CAATCACCCACTTTTTCTGACGGAGAGAGTGTTTTATCCACGACCAATCCACGCGAACTTGTTGAACATGGTACT
GATATACGAAAACAAGCCAAGTTCGAGGAAAGTGAATTGGAAAGATTGATGTCAGAGTTGAGGTTGGCGGACAAG
GAGAAGAGACCTCGAGATGCGTTGTTTCTTAAGGAAGATATTCGTCTTACGAGGGAAAGGATAGCCGAATTGCAT
CGAAGAGCTGCGAGAAGGCATTTTGATGGTCGGAATAATCTACAGAAACCTGATACGATCGATGTGCATGGATTG
AAACCAGATGAAGCTTTGTTCAGAACAGAAGAAAGACTTAGGCATTTGTTGAGGAATGGACATTCCACTTTGAAT
GTGATTGTTGGGAAGGGTCTGCATTCGCCGAATGGTGTTCCGGCGGTGAAAAACCATATTGTAAGAGAGATGCAG
AGGCAAAAAATACCTTGCAGAGTGGATCAATTCAATGCGGGTATTTTGATTCTGACATTGGCGCCTCTTGATTCG
TGA
Transcript >AgabiH97|041000
ATGGACATCGTGTTCTCGATAGCGGCAGGCTTGGGACTCCGAGTCTACCTTGTACGCGCCACTTCCCCAGCGTCG
GTCATTGCTCCAGCTATTATAGGCTTGTTCGAAGGTGTCCTCACCCACCAACTTTCATTCCGCCCTACTTCCTCC
GTTTCTTCGCCGCCTTTGGACCATTACCTGGCACTTGGCCTGCGCCTCGCCGCCGATCTGCTCTTATCCAAAAGT
CTACCAAGACTGGTGATGATTGGTCTGTGGGCCGCCATTGGCACAATTATCTCCGAATCCGCATTTCCCAGTTCC
TTGTCCTCTCTTAACAGCCGTGTCTCCAGCTCTTCCAGCCGCCGAGACAAGGAGAAGCGTCATCGCCACTCTAAA
GCCTCTCCTCCACGTATTTCCTCCCGTGTCCGTGTATATCGGTCGCCTGTCATATCAACTGCCACATCCGACCCT
CTCCCACCGCCACAAACAAGTACGCCTACTCGACCAACGGTTCAAGTCAATACTCGTAGTACACCGCCGTCTGGT
CAAACTGCCTCTTCCCCCAATTACCTAGCTGCCTCACCGCGTAGTTTCTTTTCAGACGCCGAGACACAGCCATCT
CCCTTCCCCGATTCTTCTGCGTCCCCTAAACCCATCACTGTAGTAACCCAGTTTCCATCTCGTCCTCGCTCGGCC
CTATCATTTTATGAAGGGGAGAATGATGCAGCCTCTGCGCCTGAGCCATCAGGTGGCCCAGGACGTTCCCCCCAT
CTGCTAACACCACCTGATAGTACAATACGCGAGAGAACGATGGACTCTCGTGTCGACCGTCTTTCCACCATTGAC
GAAATAACTTCTCGGTCGGAGCACGTCAGCACAGAAGATATCGATCCAAGAGAGCTTCGGAGCGAGGAAAACTAC
ATTCCCATTTCACAAGTTAATGGTGGTGGCCCACTTCCCGTTCCCAATCCCACTAGTCACTATGTAACTGATAGT
GGTACACCAGTTGCTTCTCTCCCACCTATTCTTCCCGCACCGAATAGTCCTAGTGTACCAAGTGATGAAGATGAA
CTTCGGACTCCTGGTCAACCTGTATACGAGGTTGGATCGGAATCGGATGAATTGAGGACACCTCCGGCAGTACAA
GCTCGAGTTCTTGACAATGGTACTACTGCGTCTACACCCCAGAATGCCACCAGATCGGTTGTACCTGACAATCCG
CTTTCACCGCTCATGCTTAATTCTCAATCTGATCCCATTGCGGTCCCTGGAACAACCCTCTCGTCGTACGCGATG
TTACAACCTCCTCCCGAACCTACACCTCCTTTCCCTATCGTCGCCCCAGTTCCTGCAAGACTTAAAGTACGCCCT
CAATCACCCACTTTTTCTGACGGAGAGAGTGTTTTATCCACGACCAATCCACGCGAACTTGTTGAACATGGTACT
GATATACGAAAACAAGCCAAGTTCGAGGAAAGTGAATTGGAAAGATTGATGTCAGAGTTGAGGTTGGCGGACAAG
GAGAAGAGACCTCGAGATGCGTTGTTTCTTAAGGAAGATATTCGTCTTACGAGGGAAAGGATAGCCGAATTGCAT
CGAAGAGCTGCGAGAAGGCATTTTGATGGTCGGAATAATCTACAGAAACCTGATACGATCGATGTGCATGGATTG
AAACCAGATGAAGCTTTGTTCAGAACAGAAGAAAGACTTAGGCATTTGTTGAGGAATGGACATTCCACTTTGAAT
GTGATTGTTGGGAAGGGTCTGCATTCGCCGAATGGTGTTCCGGCGGTGAAAAACCATATTGTAAGAGAGATGCAG
AGGCAAAAAATACCTTGCAGAGTGGATCAATTCAATGCGGGTATTTTGATTCTGACATTGGCGCCTCTTGATTCG
TGA
Gene >AgabiH97|041000
ATGGACATCGTGTTCTCGATAGCGGCAGGCTTGGGACTCCGAGTCTACCTTGTACGCGCCACTTCCCCAGCGTCG
GTCATTGCTCCAGCTATTATAGGCTTGTTCGAAGGTGTCCTCACCCACCAACTTTCATTCCGCCCTACTTCCTCC
GTTTCTTCGCCGCCTTTGGACCATTACCTGGCACTTGGCCTGCGCCTCGCCGCCGATCTGCTCTTATCCAAAAGT
CTACCAAGACTGGTGATGATTGGTCTGTGGGCCGCCATTGGCACAATTATCTCCGAATCCGCATTTCCCAGTTCC
TTGTCCTCTCTTAACAGCCGTGTCTCCAGCTCTTCCAGCCGCCGAGACAAGGAGAAGCGTCATCGCCACTCTAAA
GCCTCTCCTCCACGTATTTCCTCCCGTGTCCGTGTATATCGGTCGCCTGTCATATCAACTGCCACATCCGACCCT
CTCCCACCGCCACAAACAAGTACGCCTACTCGACCAACGGTTCAAGTCAATACTCGTAGTACACCGCCGTCTGGT
CAAACTGCCTCTTCCCCCAATTACCTAGCTGCCTCACCGCGTAGTTTCTTTTCAGACGCCGAGACACAGCCATCT
CCCTTCCCCGATTCTTCTGCGTCCCCTAAACCCATCACTGTAGTAACCCAGTTTCCATCTCGTCCTCGCTCGGCC
CTATCATTTTATGAAGGGGAGAATGATGCAGCCTCTGCGCCTGAGCCATCAGGTGGCCCAGGACGTTCCCCCCAT
CTGCTAACACCACCTGATAGTACAATACGCGAGAGAACGATGGACTCTCGTGTCGACCGTCTTTCCACCATTGAC
GAAATAACTTCTCGGTCGGAGCACGTCAGCACAGAAGATATCGATCCAAGAGAGCTTCGGAGCGAGGAAAACTAC
ATTCCCATTTCACAAGTTAATGGTGGTGGCCCACTTCCCGTTCCCAATCCCACTAGTCACTATGTAACTGATAGT
GGTACACCAGTTGCTTCTCTCCCACCTATTCTTCCCGCACCGAATAGTCCTAGTGTACCAAGTGATGAAGATGAA
CTTCGGACTCCTGGTCAACCTGTATACGAGGTTGGATCGGAATCGGATGAATTGAGGACACCTCCGGCAGTACAA
GCTCGAGTTCTTGACAATGGTACTACTGCGTCTACACCCCAGAATGCCACCAGATCGGTTGTACCTGACAATCCG
CTTTCACCGCTCATGCTTAATTCTCAATCTGATCCCATTGCGGTCCCTGGAACAACCCTCTCGTCGTACGCGATG
TTACAACCTCCTCCCGAACCTACACCTCCTTTCCCTATCGTCGCCCCAGTTCCTGCAAGACTTAAAGTACGCCCT
CAATCACCCACTTTTTCTGACGGAGAGAGTGTTTTATCCACGACCAATCCACGCGAACTTGTTGAACATGGTACT
GATATACGAAAACAAGCCAAGTTCGAGGAAAGTGAATTGGAAAGATTGATGTCAGAGTTGAGGTTGGCGGACAAG
GAGAAGAGACCTCGAGATGCGTTGTTTCTTAAGGAAGATATTCGTCTTACGAGGGAAAGGATAGCCGAATTGCAT
CGAAGAGCTGCGAGAAGGCATTTTGATGGTGCGTTTGATTTCTAGTGTCTACCTTGTTCATGTAATCTTAAAAGA
CTGCAATTTTCCAGGTCGGAATAATCTACAGAAACCTGATACGATCGATGTGCATGGATTGAAACCAGATGAAGC
TTTGTTCAGAACAGAAGAAAGACTTAGGCATTTGTTGAGGAATGGACATTCCACTTTGAATGTGATTGTTGGGAA
GGGTCTGCATTCGCCGAATGGTGTTCCGGCGGTGAAAAACCATATTGTAAGAGAGATGCAGAGGTATGATGATTG
ATCTTTCCCGGACATACTTTTGTGGATGCTGACACTTGGAGTGTAGGCAAAAAATACCTTGCAGAGTGGATCAAT
TCAATGCGGGTATTTTGATTCTGACATTGGCGCCTCTTGATTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail