Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040950
Gene name
Locationscaffold_2:640376..642466
Strand+
Gene length (bp)2090
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16499 Melibiase_2 Alpha galactosidase A 2.1E-56 31 309
PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain 6.9E-06 330 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WE86|AGALB_ASPFU Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglB PE=3 SV=2 1 383 6.0E-128
sp|A1D0A3|AGALB_NEOFI Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglB PE=3 SV=1 1 383 5.0E-127
sp|B8N306|AGALB_ASPFN Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglB PE=3 SV=1 27 383 5.0E-127
sp|A1C5D3|AGALB_ASPCL Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglB PE=3 SV=1 6 383 6.0E-127
sp|Q2UJ97|AGALB_ASPOR Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglB PE=3 SV=1 27 383 1.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WE86|AGALB_ASPFU Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglB PE=3 SV=2 1 383 6.0E-128
sp|A1D0A3|AGALB_NEOFI Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglB PE=3 SV=1 1 383 5.0E-127
sp|B8N306|AGALB_ASPFN Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglB PE=3 SV=1 27 383 5.0E-127
sp|A1C5D3|AGALB_ASPCL Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglB PE=3 SV=1 6 383 6.0E-127
sp|Q2UJ97|AGALB_ASPOR Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglB PE=3 SV=1 27 383 1.0E-126
sp|B0Y224|AGALB_ASPFC Probable alpha-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglB PE=3 SV=1 28 383 2.0E-126
sp|A7XZT2|AGALB_TALEM Probable alpha-galactosidase B OS=Talaromyces emersonii PE=3 SV=1 27 396 9.0E-125
sp|O94221|AGALB_PENSI Probable alpha-galactosidase B OS=Penicillium simplicissimum GN=agl1 PE=2 SV=1 28 383 7.0E-123
sp|A2QEJ9|AGALB_ASPNC Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglB PE=3 SV=1 7 383 1.0E-121
sp|Q9Y865|AGALB_ASPNG Probable alpha-galactosidase B OS=Aspergillus niger GN=aglB PE=2 SV=1 7 383 2.0E-120
sp|Q5AVQ6|AGALB_EMENI Probable alpha-galactosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglB PE=2 SV=2 1 383 2.0E-106
sp|Q9URZ0|AGAL_SCHPO Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mel1 PE=3 SV=1 28 383 5.0E-80
sp|Q9FT97|AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana GN=AGAL1 PE=2 SV=1 28 396 3.0E-75
sp|Q42656|AGAL_COFAR Alpha-galactosidase OS=Coffea arabica PE=1 SV=1 28 389 4.0E-73
sp|Q9FXT4|AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica GN=Os10g0493600 PE=1 SV=1 28 378 1.0E-72
sp|B3PGJ1|AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) GN=agaA PE=1 SV=1 4 309 2.0E-72
sp|Q8VXZ7|AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana GN=AGAL3 PE=1 SV=1 28 389 9.0E-71
sp|P14749|AGAL_CYATE Alpha-galactosidase OS=Cyamopsis tetragonoloba PE=1 SV=1 28 389 2.0E-69
sp|Q8RX86|AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana GN=AGAL2 PE=1 SV=1 31 378 1.0E-68
sp|Q55B10|AGAL_DICDI Probable alpha-galactosidase OS=Dictyostelium discoideum GN=melA PE=3 SV=1 8 388 5.0E-68
sp|Q11129|MEL_SACMI Alpha-galactosidase OS=Saccharomyces mikatae GN=MEL PE=3 SV=1 8 316 9.0E-68
sp|Q03647|MEL_SACCA Alpha-galactosidase OS=Saccharomyces pastorianus (strain ATCC 76529 / Carlsberg bottom yeast no.1 / CBS 1513 / CLIB 176 / NBRC 1167 / NCYC 396 / NRRL Y-12693) GN=MEL PE=3 SV=1 4 347 1.0E-67
sp|Q99172|MEL_LACCI Alpha-galactosidase OS=Lachancea cidri GN=MEL PE=3 SV=1 20 316 2.0E-67
sp|P41946|MEL5_YEASX Alpha-galactosidase 5 OS=Saccharomyces cerevisiae GN=MEL5 PE=3 SV=1 7 316 2.0E-67
sp|Q9P4V4|MEL_ZYGMR Alpha-galactosidase OS=Zygotorulaspora mrakii GN=MEL PE=3 SV=1 20 379 5.0E-67
sp|P41947|MEL6_YEASX Alpha-galactosidase 6 OS=Saccharomyces cerevisiae GN=MEL6 PE=3 SV=1 20 316 1.0E-66
sp|P04824|MEL1_YEASX Alpha-galactosidase 1 OS=Saccharomyces cerevisiae GN=MEL1 PE=1 SV=1 20 316 3.0E-65
sp|Q09187|MEL_SACPA Alpha-galactosidase OS=Saccharomyces paradoxus GN=MEL PE=3 SV=1 22 347 1.0E-64
sp|P41945|MEL2_YEASX Alpha-galactosidase 2 OS=Saccharomyces cerevisiae GN=MEL2 PE=3 SV=1 20 316 7.0E-64
sp|Q9UVD6|MEL_TORDE Alpha-galactosidase OS=Torulaspora delbrueckii GN=MEL PE=3 SV=1 5 347 1.0E-63
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 5 389 1.0E-56
sp|A1D9S3|AGALD_NEOFI Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglD PE=3 SV=1 29 309 1.0E-54
sp|Q5AX28|AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglD PE=1 SV=2 7 309 4.0E-54
sp|A4DA70|AGALD_ASPFU Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglD PE=3 SV=2 29 309 5.0E-54
sp|B0YEK2|AGALD_ASPFC Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglD PE=3 SV=2 29 309 5.0E-54
sp|A2R2S6|AGALD_ASPNC Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglD PE=3 SV=2 31 389 2.0E-53
sp|P06280|AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens GN=GLA PE=1 SV=1 28 310 2.0E-50
sp|B8N7Z0|AGALD_ASPFN Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglD PE=3 SV=1 4 309 2.0E-49
sp|P51569|AGAL_MOUSE Alpha-galactosidase A OS=Mus musculus GN=Gla PE=1 SV=1 28 310 3.0E-49
sp|Q2UI87|AGALD_ASPOR Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglD PE=3 SV=2 4 309 4.0E-49
sp|Q9QWR8|NAGAB_MOUSE Alpha-N-acetylgalactosaminidase OS=Mus musculus GN=Naga PE=1 SV=2 29 310 2.0E-48
sp|P17050|NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens GN=NAGA PE=1 SV=2 31 310 5.0E-47
sp|Q66H12|NAGAB_RAT Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus GN=Naga PE=2 SV=1 29 310 6.0E-47
sp|Q90744|NAGAB_CHICK Alpha-N-acetylgalactosaminidase OS=Gallus gallus GN=NAGA PE=1 SV=1 28 310 6.0E-47
sp|Q58DH9|NAGAB_BOVIN Alpha-N-acetylgalactosaminidase OS=Bos taurus GN=NAGA PE=2 SV=1 29 310 4.0E-44
sp|Q4WVZ3|AGALA_ASPFU Probable alpha-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglA PE=3 SV=1 1 309 5.0E-43
sp|A1DDD8|AGALA_NEOFI Probable alpha-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglA PE=3 SV=1 1 309 7.0E-41
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 31 381 1.0E-40
sp|A1CBW8|AGALA_ASPCL Probable alpha-galactosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglA PE=3 SV=1 3 309 2.0E-40
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 31 381 4.0E-40
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 2 382 1.0E-39
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 31 310 9.0E-39
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 30 310 2.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040950
MATFLAILTATSLALAQAPTTPPSHETGRLPALGWNTWNAYHCEIDEAKVLAAAHSFVELGLKDAGYEYVNIDDC
WSVKDSRDSSGRIVPDPTRFPNGIIGVANEVHDLGLKIGIYSDAGTQTCAGYPASLGNELIDVQTFAGWGIDYLK
YDNCNVPSNWTDAPNPPDGDWYNSNSGIRYRRMTDALSKVSRPIQLDVCIWGQAQVWTWGARTGHSWRMSGDATP
TWSYIMDIIKINVDHLDTIDFFGHNDMDMMEIGNGDLTIQEERTHFAAWAFFKSPILLGTDLSQLNSEQVAIITN
KELLAFSQDPNIGTPAKPFTPRSGAGTTSPPEFYAGASSKGMHVFIMNIGSSTTTKSFRLSNVPGLSDSGRFIIH
DMWTGTDVDGSFTAGSTFSLDDGNTEMKWVRVAYLLAKYWLDKMYKI*
Coding >AgabiH97|040950
ATGGCTACGTTTTTAGCAATCCTCACTGCCACTTCTCTCGCGCTTGCTCAAGCTCCAACAACACCCCCGTCTCAC
GAGACGGGAAGGCTACCTGCCCTAGGATGGAACACCTGGAATGCCTATCATTGTGAGATTGACGAGGCTAAGGTT
CTTGCCGCCGCACACTCGTTCGTAGAACTTGGACTCAAAGATGCGGGTTATGAATACGTCAATATTGATGACTGT
TGGTCAGTTAAGGATTCTCGTGACAGCTCTGGAAGGATCGTACCAGACCCCACGAGATTCCCAAACGGAATCATT
GGGGTCGCCAATGAAGTTCATGATCTCGGATTGAAGATAGGTATCTACAGTGACGCTGGTACACAAACTTGCGCT
GGATACCCTGCTTCTCTCGGTAATGAGCTTATTGATGTCCAAACATTCGCCGGCTGGGGCATTGACTACTTGAAA
TACGATAATTGCAATGTTCCCAGCAACTGGACTGATGCTCCCAATCCACCCGACGGTGATTGGTACAACTCGAAC
TCCGGAATCCGTTATCGCCGAATGACAGATGCTCTCTCCAAAGTATCCCGTCCGATCCAACTTGACGTCTGCATC
TGGGGTCAAGCTCAAGTTTGGACCTGGGGCGCTCGGACGGGCCACTCGTGGAGGATGTCAGGAGATGCCACCCCA
ACATGGTCGTACATCATGGACATCATTAAAATTAACGTAGACCATTTGGATACGATTGATTTCTTCGGTCACAAC
GACATGGATATGATGGAAATTGGAAATGGTGACTTGACTATTCAGGAAGAGCGTACACACTTCGCCGCCTGGGCT
TTCTTCAAGAGTCCCATATTACTTGGAACCGATCTTTCGCAACTCAACTCTGAACAAGTGGCCATCATCACTAAC
AAGGAACTACTCGCTTTCAGCCAAGATCCCAACATCGGAACACCTGCCAAGCCATTCACACCTAGATCTGGTGCT
GGTACAACCTCACCCCCCGAGTTTTACGCTGGTGCATCTTCCAAGGGCATGCACGTATTCATCATGAATATTGGA
TCATCTACCACTACGAAGTCGTTCAGGCTCTCGAACGTCCCTGGCCTCTCTGATTCCGGAAGGTTCATCATCCAC
GACATGTGGACTGGGACTGACGTGGACGGGTCTTTCACTGCGGGTTCGACGTTCAGCCTTGATGACGGAAATACC
GAAATGAAGTGGGTGCGTGTCGCGTACCTTCTTGCTAAATACTGGCTTGACAAAATGTATAAAATCTGA
Transcript >AgabiH97|040950
ATGGCTACGTTTTTAGCAATCCTCACTGCCACTTCTCTCGCGCTTGCTCAAGCTCCAACAACACCCCCGTCTCAC
GAGACGGGAAGGCTACCTGCCCTAGGATGGAACACCTGGAATGCCTATCATTGTGAGATTGACGAGGCTAAGGTT
CTTGCCGCCGCACACTCGTTCGTAGAACTTGGACTCAAAGATGCGGGTTATGAATACGTCAATATTGATGACTGT
TGGTCAGTTAAGGATTCTCGTGACAGCTCTGGAAGGATCGTACCAGACCCCACGAGATTCCCAAACGGAATCATT
GGGGTCGCCAATGAAGTTCATGATCTCGGATTGAAGATAGGTATCTACAGTGACGCTGGTACACAAACTTGCGCT
GGATACCCTGCTTCTCTCGGTAATGAGCTTATTGATGTCCAAACATTCGCCGGCTGGGGCATTGACTACTTGAAA
TACGATAATTGCAATGTTCCCAGCAACTGGACTGATGCTCCCAATCCACCCGACGGTGATTGGTACAACTCGAAC
TCCGGAATCCGTTATCGCCGAATGACAGATGCTCTCTCCAAAGTATCCCGTCCGATCCAACTTGACGTCTGCATC
TGGGGTCAAGCTCAAGTTTGGACCTGGGGCGCTCGGACGGGCCACTCGTGGAGGATGTCAGGAGATGCCACCCCA
ACATGGTCGTACATCATGGACATCATTAAAATTAACGTAGACCATTTGGATACGATTGATTTCTTCGGTCACAAC
GACATGGATATGATGGAAATTGGAAATGGTGACTTGACTATTCAGGAAGAGCGTACACACTTCGCCGCCTGGGCT
TTCTTCAAGAGTCCCATATTACTTGGAACCGATCTTTCGCAACTCAACTCTGAACAAGTGGCCATCATCACTAAC
AAGGAACTACTCGCTTTCAGCCAAGATCCCAACATCGGAACACCTGCCAAGCCATTCACACCTAGATCTGGTGCT
GGTACAACCTCACCCCCCGAGTTTTACGCTGGTGCATCTTCCAAGGGCATGCACGTATTCATCATGAATATTGGA
TCATCTACCACTACGAAGTCGTTCAGGCTCTCGAACGTCCCTGGCCTCTCTGATTCCGGAAGGTTCATCATCCAC
GACATGTGGACTGGGACTGACGTGGACGGGTCTTTCACTGCGGGTTCGACGTTCAGCCTTGATGACGGAAATACC
GAAATGAAGTGGGTGCGTGTCGCGTACCTTCTTGCTAAATACTGGCTTGACAAAATGTATAAAATCTGA
Gene >AgabiH97|040950
ATGGCTACGTTTTTAGCAATCCTCACTGCCACTTCTCTCGCGCTTGCTCAAGCTCCAACAACACCCCCGTCTCAC
GAGACGGGAAGGCTACCTGCCCTAGGGTATCTTCTTATATGTATCTTGTTCTGTTTGGAACTGCGACTGACTATG
ATGACCAGATGGAACACCTGGAATGCCTATCATTGTGGTGAGTAGAGATTTCGAGCAGCAAACAATTTCTAACCT
TCAACCTGACGCGAATTCGAATCAGAGATTGACGAGGCTAAGGTTCTTGCCGCCGCACACTCGTTCGTAGAACTT
GGACTCAAAGATGCGGGTTATGAATACGTCAATATTGATGTAAATTCTCTTGCTTCCTTACTCGGAGAGTCTCGG
TTTTGACGACATCATAGGACTGTTGGTCAGTTAAGGATTCTCGTGACAGCTCTGGAAGGATCGTACCAGACCCCA
CGAGATTCCCAAACGGAATCATTGGGGTCGCCAATGAAGTTCATGATCTCGGATTGAAGATAGGTATCTACAGGT
CAGTGTTTAATTACCGGTCAGAAATCAAGAGCTCATATGCAATAGTGACGCTGGTACACAAACTTGCGCTGGATA
CCCTGCTTCTCTCGGTAATGAGCTTATTGATGTCCAAACATTCGCCGGCTGGGGCATTGACTACTTGAAATACGG
TCAGTACATGGCGATTTCAATCAGATGTGGTTTATGAAATGGTCCCTAGATAATTGCAATGTTCCCAGCAACTGG
ACTGATGCTCCCGTGGGTTATCTTTCATTGTTCTTGCTTTGTTTGACCTAAACTATGTTAGAATCCACCCGACGG
TGATTGGTAGTAAGCAATAGTCTTTTTCTTCCAGCATTTAACTTCCGTTAACCTGGACTGGGTGATAGCAACTCG
AACTCCGGAATCCGTTATCGCCGAATGACGTAAGTTTAGAGTGAATGGATGATCTCGAAATTGAATTGAGCTAAT
TATAATTGTACTAGAGATGCTCTCTCCAAAGTATCCCGTCCGATCCAACTTGACGTCTGCATCTGGGGTCAAGCT
CAAGTTTGGACCTGGGGCGCTCGGACGGTAAGCATCTCGTACAGATGACGGTGAAGATCCAATGACGATGACAAT
GTTTAGGGCCACTCGTGGAGGATGTCAGGAGATGCCACGTGAGAAACGTCTTTCTTGCTTAAGAAACGTACAAAT
CGCTGACTTTTTTATAGCCCAACATGGTCGTACATCATGGACATCATTAAAATTAACGTAGACCATTTGGATACG
ATTGATTTCTTCGGTCACAACGACATGGATATGATGGAAATTGGTACGTGCATTTATAATCTACTCCAGTGATTG
TAGCAGCTAACATTTGATTTGACCTTCCACAGGAAATGGTGACTTGACTATTCAGGAAGAGCGTACACACTTCGC
CGCCTGGGCTTTCTTCAAGAGTCCCATATTACTGTGAGTAATGTGTCACTGACTTTGATCTAATCTGAACGTTGA
TGTGGAACTATGCAGTGGAACCGATGTAAGAGATCTTTTGAAGCGTTCTCCTCTCACATGAAAATAATTTTGTGA
CTGCATAGCTTTCGCAACTCAACTCTGAACAAGTGGCCATCATCACTAACAAGGAACTACTCGCTTTCAGCCAAG
ATCCCAACATCGGAACACCTGCCAAGCCATTCACACCTAGATCTGGTGCTGGTACAACCTCACCCCCCGAGTTTT
ACGCTGGTGCATCTTCCAAGGGCATGCACGTATTCATCATGAATATTGGATCATCTACCACTACGAAGTCGTTCA
GGCTCTCGAACGTCCCTGGCCTCTCTGATTCCGGAAGGTTCATCATCCACGACATGTGGACTGGGACTGACGTGG
ACGGGTCTTTCACTGCGGGTTCGACGTTCAGCGTCAGATTGGGTGCTCATGATACCGCCGCTTATCTGATTACTG
AAGCTTGATGACGGAAATACCGAAATGAAGTGGGTGCGTGTGTAAGTACAATTGACTCGGCAGGTTACTAGGTTC
ATATCAATGCCGATAGCGCGTACCTTCTTGCTAAATACTGGCTTGACAAAATGTATAAAATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail