Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040890
Gene name
Locationscaffold_2:630277..633428
Strand+
Gene length (bp)3151
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10497 zf-4CXXC_R1 Zinc-finger domain of monoamine-oxidase A repressor R1 2.1E-05 59 173

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040890
MPDSPSLKRKLDDTHDSHKKPRTSLSVTITLKPQLKKPFASAPIPMPNACPDYPNGFIYCHQCSKKRDVTDAIQC
TFFELPQPKEKDPEKDKPKEKSREKSPRQRRCVAKYCKFCLKNRYDVEFDDVVNAARNARFEPGHIDSAGYFYRC
PKCSDTCNCPRCRKSKGLEPMGSAGTIRHPPPEPAPKPSASKSKADRQSKKHANGDSASTAKGAKGPRKPKVKPL
PIVEWTPVPVRLPLYEAEARFHIREFVLRFADLFEPSLPRTNLEELEEIGGGRHQGRDEHDDMVSWVSEFCVKSI
IVGLLNLLAKELQGPLSMAIKNAVKDIRNLGVNLNKIWPVLAILRDSPPPPDPLLFTSPHSTLPGSSSPFTFTFP
DPLSPPSSLDIRTIRSTRTNATTDNYGIHIAYSAQMVPVVEALMEDVLMTTAVREELEEGVREGMKETIKEQKEA
VKRETERWDVVRKSMETRVKLKAQILENRAKREYHKLKNVSLENSLKTLVPKYAARFTPLGMDSEDRVYWILSPG
VSEREAAQDFIMSCSSDDKLIKSNRKKIVMKKARVLNMEERIEMKSWSWFLAVWGKRPEDAVVGSGGRQKNLKVK
AMPAETTTNVKLKIKVNGNARKENEMDVDEETGSSSEEEDDGDAGRRGAGSQSDAEDDDERDDDDHRSRSSSSSS
SSEEEEEEEEEEDKDREGWWGFYEPLEILKLSEWISMKAGLGDENKDSNISATSAVPLSTSLHSLHPHPQQKLQE
SRASSSTITLNGGTMTPSLTNDSSSSSHLNGISTGGPYHPSTTTTTTTNGGGARKSSRDTSVTTVVDHYTQTSSL
IPTRGGGGDERVRLKNLVEELRAFAVLLEWRCREDKYEGVLKDLEAAAGGAHNLGSSVVGSGSGSGGSVGGGEKG
KAKAREEEMEVDEEKEEEEEEDNERERSESGDESESGSGSESSGPSENNWNSQDEDVSMA*
Coding >AgabiH97|040890
ATGCCCGACTCGCCGTCTCTGAAGCGCAAGCTCGACGACACCCACGACAGCCACAAGAAACCCCGCACGTCCCTC
TCCGTCACCATCACCCTCAAGCCCCAGCTCAAAAAGCCCTTTGCCTCCGCCCCCATCCCCATGCCCAACGCCTGC
CCAGACTACCCCAACGGCTTCATCTACTGCCACCAGTGCAGCAAAAAACGCGATGTCACCGACGCCATCCAGTGC
ACCTTTTTCGAGCTTCCCCAGCCCAAGGAAAAAGACCCCGAAAAGGACAAGCCCAAGGAAAAGAGCAGGGAGAAA
TCTCCCCGCCAGCGCCGCTGTGTGGCCAAATATTGCAAGTTCTGCCTCAAGAACCGCTACGACGTCGAATTCGAT
GACGTAGTCAACGCCGCTCGCAACGCCAGGTTCGAGCCCGGCCACATCGACTCTGCGGGCTACTTTTACAGGTGC
CCCAAATGCTCTGATACATGTAATTGTCCCCGGTGTCGCAAGTCCAAGGGTCTCGAACCAATGGGGAGCGCGGGA
ACAATCCGTCATCCTCCACCTGAGCCCGCCCCGAAACCCTCGGCCTCCAAATCCAAGGCAGATCGCCAGTCCAAG
AAACACGCCAACGGCGACTCGGCATCCACAGCCAAAGGAGCAAAGGGTCCCAGGAAACCCAAAGTCAAGCCTCTT
CCTATCGTCGAATGGACTCCTGTACCCGTTCGCCTTCCTCTATACGAAGCCGAAGCCAGATTCCACATACGCGAG
TTTGTACTGCGCTTCGCGGACCTCTTCGAGCCTAGTTTACCTCGGACCAATCTCGAGGAACTGGAAGAGATTGGT
GGCGGTCGCCATCAAGGTCGCGATGAACATGACGACATGGTCAGCTGGGTTAGCGAATTCTGCGTCAAATCTATC
ATCGTCGGACTTCTCAACCTCCTCGCTAAAGAGCTTCAGGGCCCTCTCTCAATGGCCATCAAAAATGCTGTCAAA
GACATCCGTAACCTGGGCGTCAATCTCAATAAAATATGGCCCGTTCTAGCGATTTTACGTGATTCTCCTCCCCCT
CCAGACCCATTACTCTTCACCTCTCCGCATTCAACTCTTCCTGGTTCATCTTCTCCCTTCACCTTTACTTTTCCT
GATCCATTATCTCCTCCCTCATCTCTCGATATACGCACTATCCGAAGTACGCGTACTAATGCTACCACTGATAAT
TACGGCATACATATTGCGTACTCGGCACAGATGGTCCCCGTAGTTGAAGCGCTAATGGAGGACGTGTTGATGACA
ACTGCCGTGCGAGAGGAGCTGGAAGAAGGTGTGAGGGAAGGAATGAAAGAGACCATTAAAGAACAGAAAGAGGCT
GTGAAGCGTGAAACTGAGAGATGGGACGTTGTTAGGAAGAGTATGGAGACGCGCGTCAAACTCAAAGCTCAAATT
CTCGAGAACCGCGCGAAACGTGAATATCACAAACTTAAAAATGTATCTCTTGAAAACTCCCTTAAAACTCTTGTA
CCGAAGTACGCAGCACGATTTACGCCGCTCGGAATGGATAGCGAAGATCGAGTTTATTGGATACTTTCACCGGGA
GTTTCTGAGCGTGAAGCTGCACAAGATTTTATCATGTCCTGTTCGAGCGATGATAAACTTATCAAGAGTAACAGG
AAGAAAATTGTGATGAAGAAGGCTAGGGTTTTGAATATGGAGGAACGAATCGAGATGAAGTCGTGGAGTTGGTTT
TTGGCGGTTTGGGGAAAGAGACCTGAAGATGCTGTTGTTGGGAGTGGTGGTCGTCAGAAGAATTTAAAGGTCAAG
GCCATGCCGGCGGAGACGACGACGAATGTCAAGTTGAAAATTAAGGTTAATGGGAATGCGAGGAAGGAGAATGAG
ATGGATGTTGATGAAGAGACAGGGAGTAGCTCTGAAGAAGAAGATGATGGTGATGCGGGACGACGTGGCGCAGGT
TCTCAATCAGATGCAGAAGATGATGATGAACGGGACGATGATGATCATCGCAGTCGATCCTCATCTTCATCTTCA
TCAAGCGAAGAAGAAGAGGAAGAGGAGGAGGAAGAAGATAAGGATAGAGAAGGATGGTGGGGGTTCTATGAACCC
CTTGAGATTCTCAAATTATCTGAATGGATCTCAATGAAAGCTGGTTTGGGCGATGAAAATAAAGATTCAAACATA
TCGGCTACGAGCGCTGTTCCTTTATCGACATCATTACACTCTCTTCATCCCCATCCTCAACAAAAATTACAAGAG
TCTCGAGCATCATCATCTACAATAACACTTAACGGTGGTACGATGACTCCATCTCTCACCAACGATTCATCTTCA
TCTTCCCATCTCAACGGAATCTCCACCGGAGGACCATATCATCCTAGTACAACAACAACAACAACAACAAATGGA
GGAGGAGCAAGGAAGTCATCACGAGATACAAGTGTCACAACTGTCGTCGATCATTATACCCAGACTTCTTCTCTT
ATACCTACACGAGGTGGAGGTGGAGATGAAAGGGTGAGATTGAAGAATTTGGTGGAAGAGTTGAGGGCGTTTGCG
GTGTTGTTGGAGTGGAGGTGTAGAGAAGATAAGTATGAGGGTGTTTTGAAGGATTTGGAGGCTGCTGCGGGGGGA
GCACATAATTTGGGGAGTAGTGTTGTGGGGAGTGGGAGTGGGAGTGGGGGTAGTGTGGGTGGAGGAGAGAAGGGG
AAAGCGAAAGCGAGAGAGGAGGAGATGGAGGTGGATGAGGAGAAGGAGGAAGAGGAGGAAGAGGATAATGAAAGG
GAGAGGAGTGAGAGTGGGGATGAGAGTGAGAGTGGGAGTGGGAGTGAATCATCTGGGCCTTCTGAGAATAATTGG
AATAGTCAAGATGAAGACGTTTCTATGGCTTGA
Transcript >AgabiH97|040890
ATGCCCGACTCGCCGTCTCTGAAGCGCAAGCTCGACGACACCCACGACAGCCACAAGAAACCCCGCACGTCCCTC
TCCGTCACCATCACCCTCAAGCCCCAGCTCAAAAAGCCCTTTGCCTCCGCCCCCATCCCCATGCCCAACGCCTGC
CCAGACTACCCCAACGGCTTCATCTACTGCCACCAGTGCAGCAAAAAACGCGATGTCACCGACGCCATCCAGTGC
ACCTTTTTCGAGCTTCCCCAGCCCAAGGAAAAAGACCCCGAAAAGGACAAGCCCAAGGAAAAGAGCAGGGAGAAA
TCTCCCCGCCAGCGCCGCTGTGTGGCCAAATATTGCAAGTTCTGCCTCAAGAACCGCTACGACGTCGAATTCGAT
GACGTAGTCAACGCCGCTCGCAACGCCAGGTTCGAGCCCGGCCACATCGACTCTGCGGGCTACTTTTACAGGTGC
CCCAAATGCTCTGATACATGTAATTGTCCCCGGTGTCGCAAGTCCAAGGGTCTCGAACCAATGGGGAGCGCGGGA
ACAATCCGTCATCCTCCACCTGAGCCCGCCCCGAAACCCTCGGCCTCCAAATCCAAGGCAGATCGCCAGTCCAAG
AAACACGCCAACGGCGACTCGGCATCCACAGCCAAAGGAGCAAAGGGTCCCAGGAAACCCAAAGTCAAGCCTCTT
CCTATCGTCGAATGGACTCCTGTACCCGTTCGCCTTCCTCTATACGAAGCCGAAGCCAGATTCCACATACGCGAG
TTTGTACTGCGCTTCGCGGACCTCTTCGAGCCTAGTTTACCTCGGACCAATCTCGAGGAACTGGAAGAGATTGGT
GGCGGTCGCCATCAAGGTCGCGATGAACATGACGACATGGTCAGCTGGGTTAGCGAATTCTGCGTCAAATCTATC
ATCGTCGGACTTCTCAACCTCCTCGCTAAAGAGCTTCAGGGCCCTCTCTCAATGGCCATCAAAAATGCTGTCAAA
GACATCCGTAACCTGGGCGTCAATCTCAATAAAATATGGCCCGTTCTAGCGATTTTACGTGATTCTCCTCCCCCT
CCAGACCCATTACTCTTCACCTCTCCGCATTCAACTCTTCCTGGTTCATCTTCTCCCTTCACCTTTACTTTTCCT
GATCCATTATCTCCTCCCTCATCTCTCGATATACGCACTATCCGAAGTACGCGTACTAATGCTACCACTGATAAT
TACGGCATACATATTGCGTACTCGGCACAGATGGTCCCCGTAGTTGAAGCGCTAATGGAGGACGTGTTGATGACA
ACTGCCGTGCGAGAGGAGCTGGAAGAAGGTGTGAGGGAAGGAATGAAAGAGACCATTAAAGAACAGAAAGAGGCT
GTGAAGCGTGAAACTGAGAGATGGGACGTTGTTAGGAAGAGTATGGAGACGCGCGTCAAACTCAAAGCTCAAATT
CTCGAGAACCGCGCGAAACGTGAATATCACAAACTTAAAAATGTATCTCTTGAAAACTCCCTTAAAACTCTTGTA
CCGAAGTACGCAGCACGATTTACGCCGCTCGGAATGGATAGCGAAGATCGAGTTTATTGGATACTTTCACCGGGA
GTTTCTGAGCGTGAAGCTGCACAAGATTTTATCATGTCCTGTTCGAGCGATGATAAACTTATCAAGAGTAACAGG
AAGAAAATTGTGATGAAGAAGGCTAGGGTTTTGAATATGGAGGAACGAATCGAGATGAAGTCGTGGAGTTGGTTT
TTGGCGGTTTGGGGAAAGAGACCTGAAGATGCTGTTGTTGGGAGTGGTGGTCGTCAGAAGAATTTAAAGGTCAAG
GCCATGCCGGCGGAGACGACGACGAATGTCAAGTTGAAAATTAAGGTTAATGGGAATGCGAGGAAGGAGAATGAG
ATGGATGTTGATGAAGAGACAGGGAGTAGCTCTGAAGAAGAAGATGATGGTGATGCGGGACGACGTGGCGCAGGT
TCTCAATCAGATGCAGAAGATGATGATGAACGGGACGATGATGATCATCGCAGTCGATCCTCATCTTCATCTTCA
TCAAGCGAAGAAGAAGAGGAAGAGGAGGAGGAAGAAGATAAGGATAGAGAAGGATGGTGGGGGTTCTATGAACCC
CTTGAGATTCTCAAATTATCTGAATGGATCTCAATGAAAGCTGGTTTGGGCGATGAAAATAAAGATTCAAACATA
TCGGCTACGAGCGCTGTTCCTTTATCGACATCATTACACTCTCTTCATCCCCATCCTCAACAAAAATTACAAGAG
TCTCGAGCATCATCATCTACAATAACACTTAACGGTGGTACGATGACTCCATCTCTCACCAACGATTCATCTTCA
TCTTCCCATCTCAACGGAATCTCCACCGGAGGACCATATCATCCTAGTACAACAACAACAACAACAACAAATGGA
GGAGGAGCAAGGAAGTCATCACGAGATACAAGTGTCACAACTGTCGTCGATCATTATACCCAGACTTCTTCTCTT
ATACCTACACGAGGTGGAGGTGGAGATGAAAGGGTGAGATTGAAGAATTTGGTGGAAGAGTTGAGGGCGTTTGCG
GTGTTGTTGGAGTGGAGGTGTAGAGAAGATAAGTATGAGGGTGTTTTGAAGGATTTGGAGGCTGCTGCGGGGGGA
GCACATAATTTGGGGAGTAGTGTTGTGGGGAGTGGGAGTGGGAGTGGGGGTAGTGTGGGTGGAGGAGAGAAGGGG
AAAGCGAAAGCGAGAGAGGAGGAGATGGAGGTGGATGAGGAGAAGGAGGAAGAGGAGGAAGAGGATAATGAAAGG
GAGAGGAGTGAGAGTGGGGATGAGAGTGAGAGTGGGAGTGGGAGTGAATCATCTGGGCCTTCTGAGAATAATTGG
AATAGTCAAGATGAAGACGTTTCTATGGCTTGA
Gene >AgabiH97|040890
ATGCCCGACTCGCCGTCTCTGAAGCGCAAGCTCGACGACACCCACGACAGCCACAAGAAACCCCGCACGTCCCTC
TCCGTCACCATCACCCTCAAGCCCCAGCTCAAAAAGCCCTTTGCCTCCGCCCCCATCCCCATGCCCAACGCCTGC
CCAGACTACCCCAACGGCTTCATCTACTGCCACCAGTGCAGCAAAAAACGCGATGTCACCGGTACCCACCCCTCT
CCTTCCCCTCCGCCCCCCACCCGCTGATATCCTCCCCTAGACGCCATCCAGTGCACCTTTTTCGAGCTTCCCCAG
CCCAAGGAAAAAGACCCCGAAAAGGACAAGCCCAAGGAAAAGAGCAGGGAGAAATCTCCCCGCCAGCGCCGCTGT
GTGGCCAAATATTGCAAGTTCTGCCTCAAGAACCGCTACGACGTCGAATTCGATGACGTAGTCAACGCCGCTCGC
AACGCCAGGTTCGAGCCCGGCCACATCGACTCTGCGGGCTACTTTTACAGGTCTGTTTCTTGTCCTACAAACACG
TCGCCCCATTCACAGCTCTGCCCTAGGTGCCCCAAATGCTCTGATACATGTAATTGTCCCCGGTGTCGCAAGTCC
AAGGGTCTCGAACCAATGGGGTTTGTATTCCCTTTTTTTTCTTTCCCCTCCCCCACTCACTTTACTAAAAAACAG
GAGCGCGGGAACAATCCGTCATCCTCCACCTGAGCCCGCCCCGAAACCCTCGGCCTCCAAATCCAAGGCAGATCG
CCAGTCCAAGAAACACGCCAACGGCGACTCGGCATCCACAGCCAAAGGAGCAAAGGGTCCCAGGAAACCCAAAGT
CAAGCCTCTTCCTATCGTCGAATGGACTCCTGTACCCGTTCGCCTTCCTCTATACGAAGCCGAAGCCAGATTCCA
CATACGCGAGTTTGTACTGCGCTTCGCGGACCTCTTCGAGCCTAGTTTACCTCGGACCAATCTCGAGGAACTGGA
AGAGATTGGTGGCGGTCGCCATCAAGGTCGCGATGAACATGACGACATGGTCAGCTGGGTTAGCGAATTCTGCGT
CAAATCTATCATCGTCGGACTTCTCAACCTCCTCGCTAAAGAGCTTCAGGGCCCTCTCTCAATGGTAACTGCATA
TACACGTCTTTCATCTTTACCTCTACTGACACTGTTCGCGCAGGCCATCAAAAATGCTGTCAAAGACATCCGTAA
CCTGGGCGTCAATCTCAATAAAATATGGCCCGTTCTAGCGATTTTACGTGATTCTCCTCCCCCTCCAGACCCATT
ACTCTTCACCTCTCCGCATTCAACTCTTCCTGGTTCATCTTCTCCCTTCACCTTTACTTTTCCTGATCCATTATC
TCCTCCCTCATCTCTCGATATACGCACTATCCGAAGTACGCGTACTAATGCTACCACTGATAATTACGGCATACA
TATTGCGTACTCGGCACAGATGGTCCCCGTAGTTGAAGCGCTAATGGAGGACGTGTTGATGACAACTGCCGTGCG
AGAGGAGCTGGAAGAAGGTGTGAGGGAAGGAATGAAAGAGACCATTAAAGAACAGAAAGAGGCTGTGAAGCGTGA
AACTGAGAGATGGGACGTTGTTAGGAAGAGTATGGAGACGCGCGTCAAACTCAAAGCTCAAATTCTCGAGGTATG
TGAACAATCGCCATATTTGAATCACACCAACTTATTTTCCTGCTTTTAGAACCGCGCGAAACGTGAATATCACAA
ACTTAAAAATGTATCTCTTGAAAACTCCCTTAAAACTCTTGTACCGAAGTACGCAGCACGATTTACGCCGCTCGG
AATGGATAGCGAAGATCGAGTTTATTGGATACTTTCACCGGGAGTTTCTGAGCGTGAAGCTGCACAAGATTTTAT
CATGTCCTGTTCGAGCGATGATAAACTTATCAAGAGTAACAGGAAGAAAATTGTGATGAAGAAGGCTAGGGTTTT
GAATATGGAGGAACGAATCGAGATGAAGTCGTGGAGTTGGTTTTTGGCGGTTTGGGGAAAGAGACCTGAAGATGC
TGTTGTTGGGAGTGGTGGTCGTCAGAAGAATTTAAAGGTCAAGGCCATGCCGGCGGAGACGACGACGAATGTCAA
GTTGAAAATTAAGGTTAATGGGAATGCGAGGAAGGAGAATGAGATGGATGTTGATGAAGAGACAGGGAGTAGCTC
TGAAGAAGAAGATGATGGTGATGCGGGACGACGTGGCGCAGGTTCTCAATCAGATGCAGAAGATGATGATGAACG
GGACGATGATGATCATCGCAGTCGATCCTCATCTTCATCTTCATCAAGCGAAGAAGAAGAGGAAGAGGAGGAGGA
AGAAGATAAGGATAGAGAAGGATGGTGGGGGTTCTATGAACCCCTTGAGATTCTCAAATTATCTGAATGGATCTC
AATGAAAGCTGGTTTGGGCGATGAAAATAAAGATTCAAACATATCGGCTACGAGCGCTGTTCCTTTATCGACATC
ATTACACTCTCTTCATCCCCATCCTCAACAAAAATTACAAGAGTCTCGAGCATCATCATCTACAATAACACTTAA
CGGTGGTACGATGACTCCATCTCTCACCAACGATTCATCTTCATCTTCCCATCTCAACGGAATCTCCACCGGAGG
ACCATATCATCCTAGTACAACAACAACAACAACAACAAATGGAGGAGGAGCAAGGAAGTCATCACGAGATACAAG
TGTCACAACTGTCGTCGATCATTATACCCAGACTTCTTCTCTTATACCTACACGAGGTGGAGGTGGAGATGAAAG
GGTGAGATTGAAGAATTTGGTGGAAGAGTTGAGGGCGTTTGCGGTGTTGTTGGAGTGGAGGTGTAGAGAAGATAA
GTATGAGGGTGTTTTGAAGGATTTGGAGGCTGCTGCGGGGGGAGCACATAATTTGGGGAGTAGTGTTGTGGGGAG
TGGGAGTGGGAGTGGGGGTAGTGTGGGTGGAGGAGAGAAGGGGAAAGCGAAAGCGAGAGAGGAGGAGATGGAGGT
GGATGAGGAGAAGGAGGAAGAGGAGGAAGAGGATAATGAAAGGGAGAGGAGTGAGAGTGGGGATGAGAGTGAGAG
TGGGAGTGGGAGTGAATCATCTGGGCCTTCTGAGAATAATTGGAATAGTCAAGATGAAGACGTTTCTATGGCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail