Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040700
Gene name
Locationscaffold_2:581561..582626
Strand-
Gene length (bp)1065
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 4.9E-06 78 104
PF12874 zf-met Zinc-finger of C2H2 type 1.4E-04 79 103

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040700
MYKRGTRLNTSLTHSPPFYPFRVYNALLRSLRPLLSYLACLQPTQDHYEAVHSWCRQCDRFFANDHSRHEHYRQS
SVHFYCAPCERLFRSESNLRAHRNSSVHQPRSVKCRGKGCDRTFVSVSAMILHLEGGKCVSGIDRTYVNQKVREY
DRNNIITDPSRMLTGPSSQGESWYYATDRAWNGYAFECYLCHNTYRTLLALNQHLGSPRHQDKFYICPLDTCRTR
FRTLSGLCQHIESQRCGIHKFRVVKDTMDSVLNGMNRLTL*
Coding >AgabiH97|040700
ATGTATAAAAGGGGTACGCGGCTCAATACCTCTTTGACTCACTCCCCCCCATTCTACCCCTTCCGCGTATACAAT
GCCTTACTGCGATCGTTGCGACCGCTACTTTCGTACCTGGCCTGCCTTCAACCAACACAGGATCACTATGAAGCG
GTACATTCTTGGTGCCGACAATGCGACCGATTCTTCGCGAATGATCATAGTCGCCACGAACATTACCGCCAATCT
TCTGTACACTTTTACTGTGCACCTTGCGAACGTTTGTTTCGGTCAGAAAGCAACCTTCGGGCGCATCGCAATTCT
TCTGTTCATCAGCCTCGTAGCGTCAAATGTCGTGGCAAGGGTTGTGATAGGACATTCGTCAGCGTTTCTGCCATG
ATCCTTCACCTCGAAGGCGGCAAATGCGTCTCTGGCATTGATCGCACTTATGTTAACCAGAAAGTCCGCGAGTAT
GATCGAAACAACATCATCACCGACCCATCTCGCATGCTCACTGGGCCTAGCTCCCAAGGCGAATCCTGGTATTAC
GCGACAGATCGTGCGTGGAACGGATACGCCTTTGAGTGTTATCTGTGTCATAATACTTATCGCACCCTTCTGGCC
CTTAACCAGCATCTCGGGAGCCCTCGCCACCAGGACAAGTTTTATATATGCCCTTTAGACACGTGCCGTACAAGG
TTCAGAACTTTGAGCGGATTGTGTCAACATATCGAGAGTCAACGATGTGGTATTCACAAGTTCCGTGTTGTCAAG
GATACGATGGATTCGGTGCTTAACGGAATGAACCGTTTGACCTTGTGA
Transcript >AgabiH97|040700
ATGTATAAAAGGGGTACGCGGCTCAATACCTCTTTGACTCACTCCCCCCCATTCTACCCCTTCCGCGTATACAAT
GCCTTACTGCGATCGTTGCGACCGCTACTTTCGTACCTGGCCTGCCTTCAACCAACACAGGATCACTATGAAGCG
GTACATTCTTGGTGCCGACAATGCGACCGATTCTTCGCGAATGATCATAGTCGCCACGAACATTACCGCCAATCT
TCTGTACACTTTTACTGTGCACCTTGCGAACGTTTGTTTCGGTCAGAAAGCAACCTTCGGGCGCATCGCAATTCT
TCTGTTCATCAGCCTCGTAGCGTCAAATGTCGTGGCAAGGGTTGTGATAGGACATTCGTCAGCGTTTCTGCCATG
ATCCTTCACCTCGAAGGCGGCAAATGCGTCTCTGGCATTGATCGCACTTATGTTAACCAGAAAGTCCGCGAGTAT
GATCGAAACAACATCATCACCGACCCATCTCGCATGCTCACTGGGCCTAGCTCCCAAGGCGAATCCTGGTATTAC
GCGACAGATCGTGCGTGGAACGGATACGCCTTTGAGTGTTATCTGTGTCATAATACTTATCGCACCCTTCTGGCC
CTTAACCAGCATCTCGGGAGCCCTCGCCACCAGGACAAGTTTTATATATGCCCTTTAGACACGTGCCGTACAAGG
TTCAGAACTTTGAGCGGATTGTGTCAACATATCGAGAGTCAACGATGTGGTATTCACAAGTTCCGTGTTGTCAAG
GATACGATGGATTCGGTGCTTAACGGAATGAACCGTTTGACCTTGTGA
Gene >AgabiH97|040700
ATGTATAAAAGGGGTACGCGGCTCAATACCTCTTTGACTCACTCCCCCCCATTCTACCCCTTCCGCGGTGCGTCC
TACCCCGGTAACCAGCGACGCTACATTCGTGTCCTTATCCCTCATCCCCTCCAGTATACAATGCCTTACTGCGAT
CGTTGCGACCGCTACTTTCGTACCTGGCCTGCCTTCAACCAACACGTGAACAATTCGGCATCCCACAACATCTGC
GATGAATGTGACATCGACTTTTCCGACTGGAGTGATTTGCAGGATCATTGGGTTGAAAGCCCATACCACTCTTAT
TGTCAACCCTGTAACGAGCGTTTCGATGATGATGATGACCTAGAGGATCACTATGAAGCGGTACATTCTTGGTGC
CGACAATGCGACCGATTCTTCGCGAATGATCATAGTCGCCACGAACATTACCGCCAATCTTCTGTACACTTTTAC
TGTGCACCTTGCGAACGTTTGTTTCGGTCAGAAAGCAACCTTCGGGCGGTAAGCCTATCTATGACCCGCATACAT
CTTTGATACTGATGAGTGTTCCTCTCCCAGCATCGCAATTCTTCTGTTCATCAGCCTCGTAGCGTCAAATGTCGT
GGCAAGGGTTGTGATAGGACATTCGTCAGCGTTTCTGCCATGATCCTTCACCTCGAAGGCGGCAAATGCGTCTCT
GGCATTGATCGCACTTATGTTAACCAGAAAGTCCGCGAGTATGATCGAAACAACATCATCACCGACCCATCTCGC
ATGCTCACTGGGCCTAGCTCCCAAGGCGAATCCTGGTATTACGCGACAGATCGTGCGTGGAACGGATACGCCTTT
GAGTGTTATCTGTGTCATAATACTTATCGCACCCTTCTGGCCCTTAACCAGCATCTCGGGAGCCCTCGCCACCAG
GACAAGTTTTATATATGCCCTTTAGACACGTGCCGTACAAGGTTCAGAACTTTGAGCGGATTGTGTCAACATATC
GAGAGTCAACGATGTGGTATTCACAAGTTCCGTGTTGTCAAGGATACGATGGATTCGGTGCTTAACGGAATGAAC
CGTTTGACCTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail